SimulationCraft 902-01

for World of Warcraft 9.0.2.36532 Live (wow build level 36532)

Beta Release

Current simulator hotfixes

Death Knight

Tag Spell / Effect Field Hotfixed Value DBC Value
2020-10-25 Incorrect cooldown for Magus of the Dead's Frostbolt.
Frostbolt cooldown 3000.00 0.00
2020-09-20 Incorrect cooldown for Magus of the Dead's Frostbolt.
Frostbolt cooldown 3000.00 0.00

Mage

Tag Spell / Effect Field Hotfixed Value DBC Value
2018-12-28 Manually set Arcane Orb's travel speed.
Arcane Orb prj_speed 20.00 0.00
2017-06-21 Ice Lance is slower than spell data suggests.
Ice Lance prj_speed 47.00 50.00
2017-03-20 Manually set Frozen Orb's travel speed.
Frozen Orb prj_speed 20.00 0.00

Table of Contents

Raid Summary

Additional Raid Information

Kyrian : 11162 dps, 4911 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
11162.1 11162.1 19.7 / 0.177% 1138.9 / 10.2% 5.6
RPS Out RPS In Primary Resource Waiting APM Active Skill
1993.9 1895.5 Mana 0.00% 49.4 100.0% 100%
Talents
Kyrian

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Kyrian 11162
Arcane Barrage 3964 35.6% 55.6 5.42sec 21505 17253 Direct 166.7 6022 12088 7180 19.1%

Stats Details: Arcane Barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 55.64 166.72 0.00 0.00 1.2465 0.0000 1196652.80 1196652.80 0.00% 17252.78 17252.78
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.90% 134.88 100 174 6021.54 2082 30168 6009.24 5235 6753 811831 811831 0.00%
crit 19.10% 31.85 17 52 12087.74 4164 60336 12066.98 8149 18744 384822 384822 0.00%

Action Details: Arcane Barrage

  • id:44425
  • school:arcane
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:3.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.728000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:44425
  • name:Arcane Barrage
  • school:arcane
  • tooltip:
  • description:Launches bolts of arcane energy at the enemy target, causing {$s1=0 + 72.8%} Arcane damage. For each Arcane Charge, deals {$36032s2=30}% additional damage$?a321526[, grants you {$321526s1=2}% of your maximum mana,][]$?a231564[ and hits {$36032s3=0} additional nearby $Ltarget:targets; for {$s2=40}% of its damage][]. |cFFFFFFFFConsumes all Arcane Charges.|r

Action Priority List

    aoe
    [r]:55.64
  • if_expr:buff.arcane_charge.stack=buff.arcane_charge.max_stack
Arcane Echo 370 3.3% 59.2 4.73sec 1881 0 Direct 177.7 527 1052 627 19.1%

Stats Details: Arcane Echo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 59.23 177.68 0.00 0.00 0.0000 0.0000 111422.32 111422.32 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.93% 143.80 105 185 527.04 316 664 526.60 484 571 75770 75770 0.00%
crit 19.07% 33.88 16 58 1052.48 633 1329 1051.71 923 1196 35652 35652 0.00%

Action Details: Arcane Echo

  • id:342232
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.109200
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:342232
  • name:Arcane Echo
  • school:arcane
  • tooltip:
  • description:{$@spelldesc342231=Direct damage you deal to enemies affected by Touch of the Magi, causes an explosion that deals {$342232s1=0 + 10.9%} Arcane damage to {$s1=8} nearby enemies.}
Arcane Explosion 5021 45.0% 149.4 1.98sec 10124 8147 Direct 448.3 2830 5659 3375 19.3%

Stats Details: Arcane Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 149.43 448.29 0.00 0.00 1.2427 0.0000 1512810.13 1512810.13 0.00% 8146.88 8146.88
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.72% 361.87 271 447 2830.29 2128 6257 2830.15 2695 2930 1023981 1023981 0.00%
crit 19.28% 86.42 50 134 5659.39 4256 12513 5656.91 5017 6346 488829 488829 0.00%

Action Details: Arcane Explosion

  • id:1449
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:5000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.546000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:1449
  • name:Arcane Explosion
  • school:arcane
  • tooltip:
  • description:Causes an explosion of magic around the caster, dealing {$s2=0 + 54.6%} Arcane damage to all enemies within $A2 yards.$?a137021[ |cFFFFFFFFGenerates {$s1=1} Arcane Charge if any targets are hit.|r][]

Action Priority List

    aoe
    [q]:149.40
  • if_expr:buff.arcane_charge.stack<buff.arcane_charge.max_stack
Arcane Orb 0 (841) 0.0% (7.5%) 12.8 24.15sec 19749 15850

Stats Details: Arcane Orb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 12.84 0.00 0.00 0.00 1.2460 0.0000 0.00 0.00 0.00% 15849.80 15849.80

Action Details: Arcane Orb

  • id:153626
  • school:arcane
  • range:40.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Spelldata

  • id:153626
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r

Action Priority List

    aoe
    [p]:12.84
  • if_expr:buff.arcane_charge.stack=0
    Arcane Orb (_bolt) 841 7.5% 38.5 24.15sec 6592 0 Direct 38.5 5522 11077 6594 19.3%

Stats Details: Arcane Orb Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 38.47 38.47 0.00 0.00 0.0000 0.0000 253580.96 253580.96 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.68% 31.04 20 43 5521.65 3869 8938 5520.16 5058 6348 171342 171342 0.00%
crit 19.32% 7.43 1 17 11076.71 7739 17876 11067.48 7739 17876 82239 82239 0.00%

Action Details: Arcane Orb Bolt

  • id:153640
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.092000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:153640
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:{$@spelldesc153626=Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r}
Deathly Fixation 0 (68) 0.0% (0.6%) 14.7 1.77sec 1386 0

Stats Details: Deathly Fixation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.70 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Deathly Fixation

  • id:322253
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:42.90
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:322253
  • name:Deathly Fixation
  • school:shadow
  • tooltip:Taking $w1 Shadow damage every $t1.
  • description:Deal {$s1=43} Shadow damage every $t1. Stacks up to 5 times.
    Deathly Eruption 68 0.6% 14.7 1.77sec 1386 0 Direct 14.7 1164 2327 1386 19.1%

Stats Details: Deathly Eruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.70 14.70 0.00 0.00 0.0000 0.0000 20368.17 20368.17 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.91% 11.89 4 19 1163.53 1164 1164 1163.53 1164 1164 13838 13838 0.00%
crit 19.09% 2.81 0 9 2327.06 2327 2327 2236.36 0 2327 6531 6531 0.00%

Action Details: Deathly Eruption

  • id:322256
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:984.99
  • base_dd_max:984.99
  • base_dd_mult:1.00

Spelldata

  • id:322256
  • name:Deathly Eruption
  • school:shadow
  • tooltip:
  • description:Deal {$s1=985} Shadow damage.
Frostbolt 6 0.1% 0.0 0.00sec 0 0 Direct 1.0 1481 2961 1753 18.5%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 1.00 0.00 0.00 0.0000 0.0000 1754.81 1754.81 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.49% 0.81 0 1 1480.68 1481 1481 1206.54 0 1481 1207 1207 0.00%
crit 18.51% 0.19 0 1 2961.35 2961 2961 548.27 0 2961 548 548 0.00%

Action Details: Frostbolt

  • id:116
  • school:frost
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.511000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116
  • name:Frostbolt
  • school:frost
  • tooltip:
  • description:Launches a bolt of frost at the enemy, causing {$228597s1=0} Frost damage and slowing movement speed by {$205708s1=50}% for {$205708d=8 seconds}.
Mirror Image 0 (21) 0.0% (0.2%) 1.0 0.00sec 6102 0

Stats Details: Mirror Image

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Mirror Image

  • id:55342
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:55342
  • name:Mirror Image
  • school:arcane
  • tooltip:Damage taken is reduced by {$s3=20}% while your images are active.
  • description:Creates {$s2=3} copies of you nearby for {$55342d=40 seconds}, which cast spells and attack your enemies. While your images are active damage taken is reduced by {$s3=20}%, taking direct damage will cause one of your images to dissipate.
    Frostbolt (mirror_image) 153  / 21 0.2% 90.0 1.29sec 68 52 Direct 90.0 57 114 68 19.4%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 90.00 90.00 0.00 0.00 1.3087 0.0000 6101.74 6101.74 0.00% 51.81 51.81
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.65% 72.58 60 83 56.79 43 60 56.79 56 58 4122 4122 0.00%
crit 19.35% 17.42 7 30 113.68 86 120 113.64 102 120 1980 1980 0.00%

Action Details: Frostbolt

  • id:59638
  • school:frost
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.027000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:59638
  • name:Frostbolt
  • school:frost
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for {$d=4 seconds}.

Action Priority List

    default
    [ ]:31.00
Radiant Spark 189 1.7% 9.3 34.00sec 6125 4808 Direct 9.3 3042 6147 3655 19.7%
Periodic 60.5 319 639 381 19.3% 10.1%

Stats Details: Radiant Spark

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.31 9.31 60.47 60.47 1.2739 1.5120 57005.06 57005.06 0.00% 551.95 4808.12
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.34% 7.48 3 11 3041.85 2693 5655 3042.35 2693 3703 22741 22741 0.00%
crit 19.66% 1.83 0 6 6147.22 5386 11310 5380.78 0 11310 11246 11246 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.71% 48.80 33 67 319.14 34 501 318.74 284 349 15571 15571 0.00%
crit 19.29% 11.66 3 22 638.66 68 1003 637.91 375 854 7447 7447 0.00%

Action Details: Radiant Spark

  • id:307443
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.760000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.082400
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:10.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:307443
  • name:Radiant Spark
  • school:arcane
  • tooltip:Suffering $w2 Arcane damage every $t2 sec.
  • description:Conjure a radiant spark that causes {$s1=0 + 76.0%} Arcane damage instantly, and an additional $o2 damage over {$d=10 seconds}. The target takes {$307454s1=10}% increased damage from your direct damage spells, stacking each time they are struck. This effect ends after {$307454u=4} spells.

Action Priority List

    aoe
    [j]:4.57
  • if_expr:cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
    aoe
    [k]:3.79
  • if_expr:cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
    aoe
    [l]:0.98
  • if_expr:cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
Touch of the Magi 0 (681) 0.0% (6.1%) 5.9 54.77sec 34494 27464

Stats Details: Touch Of The Magi

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.94 0.00 0.00 0.00 1.2560 0.0000 0.00 0.00 0.00% 27463.50 27463.50

Action Details: Touch Of The Magi

  • id:321507
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:4.0

Spelldata

  • id:321507
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]

Action Priority List

    aoe
    [m]:5.97
  • if_expr:buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
    Touch of the Magi (_explosion) 681 6.1% 5.9 54.63sec 34494 0 Direct 17.8 11529 0 11529 0.0%

Stats Details: Touch Of The Magi Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.94 17.79 0.00 0.00 0.0000 0.0000 204987.58 204987.58 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 17.79 15 21 11529.15 80 40286 11531.65 8486 14511 204988 204988 0.00%

Action Details: Touch Of The Magi Explosion

  • id:210833
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:11567.30
  • base_dd_max:11567.30
  • base_dd_mult:1.00

Spelldata

  • id:210833
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:{$@spelldesc321507=Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]}
Simple Action Stats Execute Interval
Kyrian
Arcane Power 2.8 131.36sec

Stats Details: Arcane Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.80 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Arcane Power

  • id:12042
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:12042
  • name:Arcane Power
  • school:arcane
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].

Action Priority List

    aoe
    [n]:2.80
  • if_expr:((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
Berserking 1.8 262.83sec

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.80 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    shared_cds
    [v]:1.80
  • if_expr:buff.arcane_power.up
Conjure Mana Gem 1.0 0.00sec

Stats Details: Conjure Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Conjure Mana Gem

  • id:759
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:9000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:759
  • name:Conjure Mana Gem
  • school:arcane
  • tooltip:
  • description:Conjures a Mana Gem that can be used to instantly restore {$5405s1=10}% mana, and holds up to {$s2=3} charges. $@spellname118812 {$@spelldesc118812=Conjured items disappear if logged out for more than 15 minutes.}
Evocation 1.0 157.64sec

Stats Details: Evocation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 5.98 0.00 4.3136 0.7224 0.00 0.00 0.00% 0.00 0.00

Action Details: Evocation

  • id:12051
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Kyrian
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:12051
  • name:Evocation
  • school:arcane
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.

Action Priority List

    aoe
    [s]:1.00
  • interrupt_if_expr:mana.pct>=85
Spectral Flask of Power (flask) 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:307185
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Kyrian
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of Gluttonous Hedonism (food) 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:308462
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Kyrian
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Potion of Deathly Fixation (potion) 1.0 0.00sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:307497
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    shared_cds
    [u]:1.00
  • if_expr:buff.arcane_power.up
Rune of Power 5.8 53.26sec

Stats Details: Rune Of Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.79 0.00 0.00 0.00 1.2547 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Rune Of Power

  • id:116011
  • school:arcane
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:116011
  • name:Rune of Power
  • school:arcane
  • tooltip:
  • description:Places a Rune of Power on the ground for {$116011d=15 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.

Action Priority List

    aoe
    [o]:5.82
  • if_expr:buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
Replenish Mana (use_mana_gem) 2.8 123.24sec

Stats Details: Use Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.77 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Use Mana Gem

  • id:5405
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Kyrian
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5405
  • name:Replenish Mana
  • school:physical
  • tooltip:Restoring $w2 mana every $t1 sec.
  • description:Restores {$s1=10}% mana.

Action Priority List

    shared_cds
    [t]:2.78
  • if_expr:(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Arcane Charge 56.3 150.3 5.3sec 1.4sec 3.9sec 72.15% 0.00% 0.1 (0.2) 0.0

Buff Details

  • buff initial source:Kyrian
  • cooldown name:buff_arcane_charge
  • max_stacks:4
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 13.5s
  • trigger_min/max:0.0s / 8.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.9s

Stack Uptimes

  • arcane_charge_1:18.71%
  • arcane_charge_2:15.98%
  • arcane_charge_3:16.09%
  • arcane_charge_4:21.37%

Spelldata

  • id:36032
  • name:Arcane Charge
  • tooltip:Increases the damage of Arcane Blast, Arcane Missiles, Arcane Explosion, and Arcane Barrage by $36032w1%. Increases the mana cost of Arcane Blast by $36032w2%$?{$w5<0}[, and reduces the cast time of Arcane Blast by $w5%.][.] Increases the number of targets hit by Arcane Barrage for 50% damage by $36032w3.
  • description:$@spelldesc114664
  • max_stacks:4
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Arcane Power 2.8 0.0 131.3sec 131.3sec 14.6sec 13.57% 0.00% 0.0 (0.0) 2.7

Buff Details

  • buff initial source:Kyrian
  • cooldown name:buff_arcane_power
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:120.4s / 138.9s
  • trigger_min/max:120.4s / 138.9s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 15.0s

Stack Uptimes

  • arcane_power_1:13.57%

Spelldata

  • id:12042
  • name:Arcane Power
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
Berserking 1.8 0.0 262.4sec 262.4sec 11.6sec 6.88% 23.34% 0.0 (0.0) 1.7

Buff Details

  • buff initial source:Kyrian
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:241.0s / 272.0s
  • trigger_min/max:241.0s / 272.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 12.0s

Stack Uptimes

  • berserking_1:6.88%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.45% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Kyrian
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.45%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Clearcasting 23.9 0.2 12.2sec 12.1sec 2.1sec 16.32% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Kyrian
  • cooldown name:buff_clearcasting
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stack Uptimes

  • clearcasting_1:16.12%
  • clearcasting_2:0.21%
  • clearcasting_3:0.06%

Spelldata

  • id:263725
  • name:Clearcasting
  • tooltip:Your next Arcane Missiles or Arcane Explosion costs no mana{$?s321758=false}[ and Arcane Missiles fires an additional missile][].
  • description:{$@spelldesc79684=For each ${$c*100/{$s1=200}} mana you spend, you have a 1% chance to gain Clearcasting, making your next Arcane Missiles or Arcane Explosion free and channel {$277726s1=20}% faster.$?a321758[ Arcane Missiles fires {$321758s2=1} additional missile.][]}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Evocation 1.0 0.0 168.5sec 168.5sec 4.3sec 1.43% 0.00% 4.0 (4.0) 0.0

Buff Details

  • buff initial source:Kyrian
  • cooldown name:buff_evocation
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:7.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:1.00

Trigger Details

  • interval_min/max:116.7s / 229.1s
  • trigger_min/max:116.7s / 229.1s
  • trigger_pct:100.00%
  • duration_min/max:0.4s / 4.3s

Stack Uptimes

  • evocation_1:1.43%

Spelldata

  • id:12051
  • name:Evocation
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Deathly Fixation 1.0 0.0 0.0sec 0.0sec 25.0sec 8.40% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Kyrian
  • cooldown name:buff_potion_of_deathly_fixation
  • max_stacks:1
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:25.0s / 25.0s

Stack Uptimes

  • potion_of_deathly_fixation_1:8.40%

Spelldata

  • id:307497
  • name:Potion of Deathly Fixation
  • tooltip:Chance to apply Deathly Fixation to your target.
  • description:Your damaging spells and abilities have a chance to apply Deathly Fixation to your target, dealing {$322253s1=43} Shadow damage over {$322253d=8 seconds} and stacking up to 5 times. Upon reaching 5 stacks, Deathly Fixation explodes, dealing {$322256s1=985} Shadow damage to the target. If you consume this potion while your weapon is augmented with Shadowcore Oil, the explosion damage is increased by {$s2=10}%. Lasts {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Rune of Power 8.6 0.0 36.6sec 36.6sec 14.6sec 41.69% 0.00% 0.0 (0.0) 8.2

Buff Details

  • buff initial source:Kyrian
  • cooldown name:buff_rune_of_power
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.40
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:16.8s / 55.3s
  • trigger_min/max:16.8s / 55.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • rune_of_power_1:41.69%

Spelldata

  • id:116014
  • name:Rune of Power
  • tooltip:Spell damage increased by $w1%.$?$w2=0[][ Health restored by $w2% per second.]
  • description:{$@spelldesc116011=Places a Rune of Power on the ground for {$116011d=15 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Well Fed (feast_of_gluttonous_hedonism)

Buff Details

  • buff initial source:Kyrian
  • cooldown name:buff_feast_of_gluttonous_hedonism
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327708
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=20}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Spectral Flask of Power

Buff Details

  • buff initial source:Kyrian
  • cooldown name:buff_spectral_flask_of_power
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:307185
  • name:Spectral Flask of Power
  • tooltip:$pri increased by $w1.
  • description:Increases $pri by {$s1=70} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs, Uptimes & Benefits

Benefit Avg % Min Max
Arcane Barrage Arcane Charge 4 100.00% 100.00% 100.00%
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 2.39% 0.82% 6.51% 0.9s 0.0s 4.7s
Conserve Phase 100.00% 100.00% 100.00% 301.4s 240.2s 359.7s

Cooldown waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Mirror Image0.0000.0000.000181.465120.158239.654
Evocation166.78626.694335.253226.295143.760357.721
Rune of Power8.5711.13629.93051.62631.85580.926
Touch of the Magi7.1751.13529.90945.11530.55080.459
Arcane Power8.1140.37218.93423.2982.70934.273
Arcane Barrage2.9230.0039.585163.720128.994196.604
Arcane Orb4.0830.01411.78952.95641.52568.774
Radiant Spark2.4330.00022.28123.4489.70258.634

Burn Phases

Burn phase duration tracks the amount of time spent in each burn phase. This is defined as the time between a start_burn_phase and stop_burn_phase action being executed. Note that "execute" burn phases, i.e., the final burn of a fight, is also included.

Burn Phase Duration
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Mana at burn start is the mana level recorded (in percentage of total mana) when a start_burn_phase command is executed.

Mana at Burn Start
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
Kyrian
mana_regen Mana 624.99 370576.36 64.86% 592.93 10849.87 2.84%
Evocation Mana 47.86 48196.15 8.43% 1007.07 0.00 0.00%
Mana Gem Mana 2.78 17603.17 3.08% 6337.14 0.00 0.00%
Arcane Barrage Mana 55.64 135011.03 23.63% 2426.49 6029.39 4.27%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 62371.4 1895.47 1993.94 16866.1 33684.9 157.9 63371.4
Usage Type Count Total Avg RPE APR
Kyrian
arcane_explosion Mana 149.4 570179.2 3816.4 3815.7 2.7
arcane_orb Mana 12.8 5742.2 447.1 447.2 44.2
radiant_spark Mana 9.3 9160.1 984.2 984.2 6.2
touch_of_the_magi Mana 5.9 14859.6 2500.0 2500.5 13.8

Statistics & Data Analysis

Fight Length
Kyrian Fight Length
Count 821
Mean 301.46
Minimum 240.16
Maximum 359.65
Spread ( max - min ) 119.50
Range [ ( max - min ) / 2 * 100% ] 19.82%
DPS
Kyrian Damage Per Second
Count 821
Mean 11162.09
Minimum 10283.67
Maximum 12040.75
Spread ( max - min ) 1757.08
Range [ ( max - min ) / 2 * 100% ] 7.87%
Standard Deviation 288.4761
5th Percentile 10681.73
95th Percentile 11641.70
( 95th Percentile - 5th Percentile ) 959.97
Mean Distribution
Standard Deviation 10.0679
95.00% Confidence Interval ( 11142.35 - 11181.82 )
Normalized 95.00% Confidence Interval ( 99.82% - 100.18% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 26
0.1% Error 2566
0.1 Scale Factor Error with Delta=300 711
0.05 Scale Factor Error with Delta=300 2842
0.01 Scale Factor Error with Delta=300 71041
Priority Target DPS
Kyrian Priority Target Damage Per Second
Count 821
Mean 4910.97
Minimum 4447.41
Maximum 5560.77
Spread ( max - min ) 1113.36
Range [ ( max - min ) / 2 * 100% ] 11.34%
Standard Deviation 173.3699
5th Percentile 4636.49
95th Percentile 5203.36
( 95th Percentile - 5th Percentile ) 566.87
Mean Distribution
Standard Deviation 6.0507
95.00% Confidence Interval ( 4899.11 - 4922.83 )
Normalized 95.00% Confidence Interval ( 99.76% - 100.24% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 48
0.1% Error 4788
0.1 Scale Factor Error with Delta=300 257
0.05 Scale Factor Error with Delta=300 1027
0.01 Scale Factor Error with Delta=300 25659
DPS(e)
Kyrian Damage Per Second (Effective)
Count 821
Mean 11162.09
Minimum 10283.67
Maximum 12040.75
Spread ( max - min ) 1757.08
Range [ ( max - min ) / 2 * 100% ] 7.87%
Damage
Kyrian Damage
Count 821
Mean 3358581.84
Minimum 2563855.68
Maximum 4058307.40
Spread ( max - min ) 1494451.72
Range [ ( max - min ) / 2 * 100% ] 22.25%
DTPS
Kyrian Damage Taken Per Second
Count 821
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Kyrian Healing Per Second
Count 821
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Kyrian Healing Per Second (Effective)
Count 821
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Kyrian Heal
Count 821
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Kyrian Healing Taken Per Second
Count 821
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Kyrian Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
KyrianTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Kyrian Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 variable,name=prepull_evo,op=reset,default=0
1 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
2 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
3 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
4 0.00 variable,name=have_opened,op=reset,default=0
5 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
6 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
7 0.00 variable,name=final_burn,op=set,value=0
8 0.00 variable,name=rs_max_delay,op=reset,default=5
9 0.00 variable,name=ap_max_delay,op=reset,default=10
A 0.00 variable,name=rop_max_delay,op=reset,default=20
B 0.00 variable,name=totm_max_delay,op=reset,default=5
C 0.00 variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
D 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
E 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
F 0.00 variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
G 0.00 variable,name=barrage_mana_pct,op=reset,default=70
H 0.00 variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
I 0.00 variable,name=ap_minimum_mana_pct,op=reset,default=30
J 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
K 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
L 0.00 variable,name=totm_max_charges,op=reset,default=2
M 0.00 variable,name=aoe_totm_max_charges,op=reset,default=2
N 0.00 variable,name=am_spam,op=reset,default=0
O 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
P 0.00 variable,name=am_spam_evo_pct,op=reset,default=15
Q 0.00 flask
R 0.00 food
S 0.00 augmentation
T 0.00 arcane_familiar
U 0.00 arcane_intellect
V 0.00 conjure_mana_gem
W 0.00 snapshot_stats
X 0.00 mirror_image
Y 0.00 frostbolt,if=variable.prepull_evo<=0
Z 0.00 evocation,if=variable.prepull_evo>0
Default action list Executed every time the actor is available.
# count action,conditions
0.00 counterspell,if=target.debuff.casting.react
a 0.00 call_action_list,name=shared_cds
b 0.00 call_action_list,name=essences
c 0.00 call_action_list,name=aoe,if=active_enemies>2
d 0.00 call_action_list,name=opener,if=variable.have_opened<=0
e 0.00 call_action_list,name=am_spam,if=variable.am_spam=1
f 0.00 call_action_list,name=cooldowns
g 0.00 call_action_list,name=rotation,if=variable.final_burn=0
h 0.00 call_action_list,name=final_burn,if=variable.final_burn=1
i 0.00 call_action_list,name=movement
actions.aoe
# count action,conditions
0.00 frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
0.00 arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
0.00 mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
j 4.57 radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
k 3.79 radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
l 0.98 radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
m 5.97 touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
n 2.80 arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
o 5.82 rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
0.00 presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
0.00 arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
0.00 supernova
p 12.84 arcane_orb,if=buff.arcane_charge.stack=0
0.00 nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
0.00 shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
q 149.40 arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
0.00 arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
r 55.64 arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
s 1.00 evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.shared_cds
# count action,conditions
t 2.78 use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
0.00 use_items,if=buff.arcane_power.up
u 1.00 potion,if=buff.arcane_power.up
0.00 time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
0.00 lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
0.00 bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
v 1.80 berserking,if=buff.arcane_power.up
0.00 blood_fury,if=buff.arcane_power.up
0.00 fireblood,if=buff.arcane_power.up
0.00 ancestral_call,if=buff.arcane_power.up

Sample Sequence

045789ABGILMNPQRVXYkmnuvrprqqqqrqqqqrqqqqorqqqtqrprqqqqrjqqqqrqqqqrqqqqrprqqqqrqqqqrkmorprqqqqrqqqqrqqqqrprqjqqqrqqqqrqqqqrmorprqqqqrqqqqlnrqqqqtrprqqqqrqqqqrqqqqrkmorprqqqqrqqqqrqqqqrprqjqqqrqqsqqrmorprqqqqrqjqqqrqqqqrprqqqqrqqqqrqqqqtrkmnvrprqqqqrqqqqrqqqqorprqqjqqrqqqqrqqqqrprqqqqrqqqqrqqq

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 prepull_evo Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 4 have_opened Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 5 have_opened Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 7 final_burn Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 8 rs_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 9 ap_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat A rop_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat B totm_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat G barrage_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat I ap_minimum_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat L totm_max_charges Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat M aoe_totm_max_charges Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat N am_spam Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat P am_spam_evo_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat Q flask Kyrian 63371.4/63371: 100% mana
Pre precombat R food Kyrian 63371.4/63371: 100% mana
Pre precombat V conjure_mana_gem Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat X mirror_image Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat Y frostbolt Fluffy_Pillow 63371.4/63371: 100% mana
0:00.000 aoe k radiant_spark Fluffy_Pillow 62371.4/63371: 98% mana clearcasting
0:01.305 aoe m touch_of_the_magi Fluffy_Pillow 62375.2/63371: 98% mana bloodlust, clearcasting
0:02.311 aoe n arcane_power Fluffy_Pillow 60876.5/63371: 96% mana bloodlust, arcane_charge(4), clearcasting
0:02.311 shared_cds u potion Fluffy_Pillow 60876.5/63371: 96% mana bloodlust, arcane_charge(4), arcane_power, clearcasting, rune_of_power
0:02.311 shared_cds v berserking Fluffy_Pillow 60876.5/63371: 96% mana bloodlust, arcane_charge(4), arcane_power, clearcasting, rune_of_power, potion_of_deathly_fixation
0:02.311 aoe r arcane_barrage Fluffy_Pillow 60876.5/63371: 96% mana bloodlust, berserking, arcane_charge(4), arcane_power, clearcasting, rune_of_power, potion_of_deathly_fixation
0:03.225 aoe p arcane_orb Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_power, clearcasting, rune_of_power, potion_of_deathly_fixation
0:04.139 aoe r arcane_barrage Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_charge(4), arcane_power, clearcasting, rune_of_power, potion_of_deathly_fixation
0:05.054 aoe q arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_power, clearcasting, rune_of_power, potion_of_deathly_fixation
0:05.969 aoe q arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, potion_of_deathly_fixation
0:06.882 aoe q arcane_explosion Fluffy_Pillow 62028.6/63371: 98% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, potion_of_deathly_fixation
0:07.798 aoe q arcane_explosion Fluffy_Pillow 60689.6/63371: 96% mana bloodlust, berserking, arcane_charge(3), arcane_power, rune_of_power, potion_of_deathly_fixation
0:08.712 aoe r arcane_barrage Fluffy_Pillow 59348.0/63371: 94% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:09.627 aoe q arcane_explosion Fluffy_Pillow 63042.5/63371: 99% mana bloodlust, berserking, arcane_power, rune_of_power, potion_of_deathly_fixation
0:10.541 aoe q arcane_explosion Fluffy_Pillow 61701.0/63371: 97% mana bloodlust, berserking, arcane_charge, arcane_power, clearcasting, rune_of_power, potion_of_deathly_fixation
0:11.456 aoe q arcane_explosion Fluffy_Pillow 62860.7/63371: 99% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, potion_of_deathly_fixation
0:12.371 aoe q arcane_explosion Fluffy_Pillow 61520.4/63371: 97% mana bloodlust, berserking, arcane_charge(3), arcane_power, rune_of_power, potion_of_deathly_fixation
0:13.285 aoe r arcane_barrage Fluffy_Pillow 60178.8/63371: 95% mana bloodlust, berserking, arcane_charge(4), arcane_power, clearcasting, rune_of_power, potion_of_deathly_fixation
0:14.199 aoe q arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_power, clearcasting, rune_of_power, potion_of_deathly_fixation
0:15.112 aoe q arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, arcane_charge, arcane_power, rune_of_power, potion_of_deathly_fixation
0:16.121 aoe q arcane_explosion Fluffy_Pillow 62150.3/63371: 98% mana bloodlust, arcane_charge(2), arcane_power, clearcasting, rune_of_power, potion_of_deathly_fixation
0:17.128 aoe q arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, arcane_charge(3), arcane_power, rune_of_power, potion_of_deathly_fixation
0:18.135 aoe o rune_of_power Fluffy_Pillow 62147.7/63371: 98% mana bloodlust, arcane_charge(4), potion_of_deathly_fixation
0:19.140 aoe r arcane_barrage Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, arcane_charge(4), rune_of_power, potion_of_deathly_fixation
0:20.147 aoe q arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, rune_of_power, potion_of_deathly_fixation
0:21.154 aoe q arcane_explosion Fluffy_Pillow 59647.7/63371: 94% mana bloodlust, arcane_charge, rune_of_power, potion_of_deathly_fixation
0:22.158 aoe q arcane_explosion Fluffy_Pillow 55920.2/63371: 88% mana bloodlust, arcane_charge(2), rune_of_power, potion_of_deathly_fixation
0:23.167 shared_cds t use_mana_gem Kyrian 52199.1/63371: 82% mana bloodlust, arcane_charge(3), rune_of_power, potion_of_deathly_fixation
0:23.167 aoe q arcane_explosion Fluffy_Pillow 58536.2/63371: 92% mana bloodlust, arcane_charge(3), rune_of_power, potion_of_deathly_fixation
0:24.173 aoe r arcane_barrage Fluffy_Pillow 54811.2/63371: 86% mana bloodlust, arcane_charge(4), clearcasting, rune_of_power, potion_of_deathly_fixation
0:25.177 aoe p arcane_orb Fluffy_Pillow 58618.6/63371: 93% mana bloodlust, clearcasting, rune_of_power, potion_of_deathly_fixation
0:26.183 aoe r arcane_barrage Fluffy_Pillow 59393.6/63371: 94% mana bloodlust, arcane_charge(4), clearcasting, rune_of_power, potion_of_deathly_fixation
0:27.188 aoe q arcane_explosion Fluffy_Pillow 63202.3/63371: 100% mana bloodlust, clearcasting, rune_of_power, potion_of_deathly_fixation
0:28.196 aoe q arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, arcane_charge, rune_of_power
0:29.201 aoe q arcane_explosion Fluffy_Pillow 59645.2/63371: 94% mana bloodlust, arcane_charge(2), rune_of_power
0:30.207 aoe q arcane_explosion Fluffy_Pillow 55920.2/63371: 88% mana bloodlust, arcane_charge(3), rune_of_power
0:31.214 aoe r arcane_barrage Fluffy_Pillow 52196.5/63371: 82% mana bloodlust, arcane_charge(4), clearcasting, rune_of_power
0:32.220 aoe j radiant_spark Fluffy_Pillow 56006.4/63371: 88% mana bloodlust, clearcasting, rune_of_power
0:33.226 aoe q arcane_explosion Fluffy_Pillow 56281.5/63371: 89% mana bloodlust, clearcasting, rune_of_power
0:34.232 aoe q arcane_explosion Fluffy_Pillow 57556.5/63371: 91% mana bloodlust, arcane_charge
0:35.238 aoe q arcane_explosion Fluffy_Pillow 53831.5/63371: 85% mana bloodlust, arcane_charge(2)
0:36.246 aoe q arcane_explosion Fluffy_Pillow 50109.1/63371: 79% mana bloodlust, arcane_charge(3)
0:37.252 aoe r arcane_barrage Fluffy_Pillow 46384.1/63371: 73% mana bloodlust, arcane_charge(4)
0:38.259 aoe q arcane_explosion Fluffy_Pillow 50195.3/63371: 79% mana bloodlust
0:39.265 aoe q arcane_explosion Fluffy_Pillow 46470.3/63371: 73% mana bloodlust, arcane_charge, clearcasting
0:40.272 aoe q arcane_explosion Fluffy_Pillow 47746.6/63371: 75% mana bloodlust, arcane_charge(2)
0:41.278 aoe q arcane_explosion Fluffy_Pillow 44021.6/63371: 69% mana arcane_charge(3)
0:42.584 aoe r arcane_barrage Fluffy_Pillow 40676.9/63371: 64% mana arcane_charge(4)
0:43.891 aoe q arcane_explosion Fluffy_Pillow 44868.3/63371: 71% mana
0:45.199 aoe q arcane_explosion Fluffy_Pillow 41526.1/63371: 66% mana arcane_charge
0:46.505 aoe q arcane_explosion Fluffy_Pillow 38181.3/63371: 60% mana arcane_charge(2), clearcasting
0:47.814 aoe q arcane_explosion Fluffy_Pillow 39840.4/63371: 63% mana arcane_charge(3)
0:49.120 aoe r arcane_barrage Fluffy_Pillow 36495.7/63371: 58% mana arcane_charge(4), clearcasting
0:50.426 aoe p arcane_orb Fluffy_Pillow 40685.8/63371: 64% mana clearcasting
0:51.734 aoe r arcane_barrage Fluffy_Pillow 41843.6/63371: 66% mana arcane_charge(4), clearcasting
0:53.038 aoe q arcane_explosion Fluffy_Pillow 46031.2/63371: 73% mana clearcasting
0:54.344 aoe q arcane_explosion Fluffy_Pillow 47686.4/63371: 75% mana arcane_charge
0:55.649 aoe q arcane_explosion Fluffy_Pillow 44340.4/63371: 70% mana arcane_charge(2)
0:56.955 aoe q arcane_explosion Fluffy_Pillow 40995.7/63371: 65% mana arcane_charge(3)
0:58.262 aoe r arcane_barrage Fluffy_Pillow 37652.2/63371: 59% mana arcane_charge(4), clearcasting
0:59.568 aoe q arcane_explosion Fluffy_Pillow 41842.3/63371: 66% mana clearcasting
1:00.875 aoe q arcane_explosion Fluffy_Pillow 43498.9/63371: 69% mana arcane_charge
1:02.181 aoe q arcane_explosion Fluffy_Pillow 40154.1/63371: 63% mana arcane_charge(2)
1:03.487 aoe q arcane_explosion Fluffy_Pillow 36809.4/63371: 58% mana arcane_charge(3)
1:04.793 aoe r arcane_barrage Fluffy_Pillow 33464.7/63371: 53% mana arcane_charge(4), clearcasting
1:06.099 aoe k radiant_spark Fluffy_Pillow 37654.8/63371: 59% mana clearcasting
1:07.406 aoe m touch_of_the_magi Fluffy_Pillow 38311.3/63371: 60% mana clearcasting
1:08.713 aoe o rune_of_power Fluffy_Pillow 37467.8/63371: 59% mana arcane_charge(4), clearcasting
1:10.019 aoe r arcane_barrage Fluffy_Pillow 39123.1/63371: 62% mana arcane_charge(4), clearcasting, rune_of_power
1:11.325 aoe p arcane_orb Fluffy_Pillow 43313.2/63371: 68% mana clearcasting, rune_of_power
1:12.633 aoe r arcane_barrage Fluffy_Pillow 44471.0/63371: 70% mana arcane_charge(4), clearcasting, rune_of_power
1:13.941 aoe q arcane_explosion Fluffy_Pillow 48663.7/63371: 77% mana clearcasting, rune_of_power
1:15.247 aoe q arcane_explosion Fluffy_Pillow 50318.9/63371: 79% mana arcane_charge, rune_of_power
1:16.554 aoe q arcane_explosion Fluffy_Pillow 46975.5/63371: 74% mana arcane_charge(2), rune_of_power
1:17.860 aoe q arcane_explosion Fluffy_Pillow 43630.7/63371: 69% mana arcane_charge(3), rune_of_power
1:19.167 aoe r arcane_barrage Fluffy_Pillow 40287.2/63371: 64% mana arcane_charge(4), clearcasting, rune_of_power
1:20.472 aoe q arcane_explosion Fluffy_Pillow 44476.1/63371: 70% mana clearcasting, rune_of_power
1:21.778 aoe q arcane_explosion Fluffy_Pillow 46131.4/63371: 73% mana arcane_charge, rune_of_power
1:23.085 aoe q arcane_explosion Fluffy_Pillow 42787.9/63371: 68% mana arcane_charge(2), rune_of_power
1:24.392 aoe q arcane_explosion Fluffy_Pillow 39444.4/63371: 62% mana arcane_charge(3), clearcasting, rune_of_power
1:25.699 aoe r arcane_barrage Fluffy_Pillow 41100.9/63371: 65% mana arcane_charge(4)
1:27.006 aoe q arcane_explosion Fluffy_Pillow 45292.3/63371: 71% mana
1:28.313 aoe q arcane_explosion Fluffy_Pillow 41948.9/63371: 66% mana arcane_charge
1:29.619 aoe q arcane_explosion Fluffy_Pillow 38604.1/63371: 61% mana arcane_charge(2)
1:30.926 aoe q arcane_explosion Fluffy_Pillow 35260.7/63371: 56% mana arcane_charge(3), clearcasting
1:32.232 aoe r arcane_barrage Fluffy_Pillow 36915.9/63371: 58% mana arcane_charge(4)
1:33.538 aoe p arcane_orb Fluffy_Pillow 41106.0/63371: 65% mana
1:34.845 aoe r arcane_barrage Fluffy_Pillow 42262.6/63371: 67% mana arcane_charge(4)
1:36.151 aoe q arcane_explosion Fluffy_Pillow 46452.7/63371: 73% mana
1:37.457 aoe j radiant_spark Fluffy_Pillow 43107.9/63371: 68% mana arcane_charge
1:38.763 aoe q arcane_explosion Fluffy_Pillow 43763.2/63371: 69% mana arcane_charge
1:40.067 aoe q arcane_explosion Fluffy_Pillow 40415.9/63371: 64% mana arcane_charge(2)
1:41.373 aoe q arcane_explosion Fluffy_Pillow 37071.2/63371: 58% mana arcane_charge(3), clearcasting
1:42.680 aoe r arcane_barrage Fluffy_Pillow 38727.7/63371: 61% mana arcane_charge(4)
1:43.985 aoe q arcane_explosion Fluffy_Pillow 42916.6/63371: 68% mana
1:45.291 aoe q arcane_explosion Fluffy_Pillow 39571.8/63371: 62% mana arcane_charge
1:46.598 aoe q arcane_explosion Fluffy_Pillow 36228.4/63371: 57% mana arcane_charge(2)
1:47.904 aoe q arcane_explosion Fluffy_Pillow 32883.6/63371: 52% mana arcane_charge(3)
1:49.210 aoe r arcane_barrage Fluffy_Pillow 29538.9/63371: 47% mana arcane_charge(4)
1:50.516 aoe q arcane_explosion Fluffy_Pillow 33729.0/63371: 53% mana
1:51.822 aoe q arcane_explosion Fluffy_Pillow 30384.3/63371: 48% mana arcane_charge
1:53.129 aoe q arcane_explosion Fluffy_Pillow 27040.8/63371: 43% mana arcane_charge(2)
1:54.437 aoe q arcane_explosion Fluffy_Pillow 23698.6/63371: 37% mana arcane_charge(3)
1:55.744 aoe r arcane_barrage Fluffy_Pillow 20355.1/63371: 32% mana arcane_charge(4)
1:57.052 aoe m touch_of_the_magi Fluffy_Pillow 24547.8/63371: 39% mana
1:58.358 aoe o rune_of_power Fluffy_Pillow 23703.0/63371: 37% mana arcane_charge(4)
1:59.665 aoe r arcane_barrage Fluffy_Pillow 25359.6/63371: 40% mana arcane_charge(4), rune_of_power
2:00.972 aoe p arcane_orb Fluffy_Pillow 29551.0/63371: 47% mana rune_of_power
2:02.278 aoe r arcane_barrage Fluffy_Pillow 30706.2/63371: 48% mana arcane_charge(4), rune_of_power
2:03.584 aoe q arcane_explosion Fluffy_Pillow 34896.3/63371: 55% mana rune_of_power
2:04.890 aoe q arcane_explosion Fluffy_Pillow 31551.6/63371: 50% mana arcane_charge, rune_of_power
2:06.197 aoe q arcane_explosion Fluffy_Pillow 28208.1/63371: 45% mana arcane_charge(2), rune_of_power
2:07.504 aoe q arcane_explosion Fluffy_Pillow 24864.7/63371: 39% mana arcane_charge(3), rune_of_power
2:08.810 aoe r arcane_barrage Fluffy_Pillow 21519.9/63371: 34% mana arcane_charge(4), rune_of_power
2:10.117 aoe q arcane_explosion Fluffy_Pillow 25711.3/63371: 41% mana rune_of_power
2:11.425 aoe q arcane_explosion Fluffy_Pillow 22369.1/63371: 35% mana arcane_charge, clearcasting, rune_of_power
2:12.731 aoe q arcane_explosion Fluffy_Pillow 24024.4/63371: 38% mana arcane_charge(2), rune_of_power
2:14.036 aoe q arcane_explosion Fluffy_Pillow 20678.4/63371: 33% mana arcane_charge(3), rune_of_power
2:15.342 aoe l radiant_spark Fluffy_Pillow 17333.6/63371: 27% mana arcane_charge(4)
2:16.649 aoe n arcane_power Fluffy_Pillow 17990.1/63371: 28% mana arcane_charge(4), clearcasting
2:16.649 aoe r arcane_barrage Fluffy_Pillow 17990.1/63371: 28% mana arcane_charge(4), arcane_power, clearcasting, rune_of_power
2:17.955 aoe q arcane_explosion Fluffy_Pillow 22180.3/63371: 35% mana arcane_power, clearcasting, rune_of_power
2:19.259 aoe q arcane_explosion Fluffy_Pillow 23833.0/63371: 38% mana arcane_charge, arcane_power, rune_of_power
2:20.566 aoe q arcane_explosion Fluffy_Pillow 22989.5/63371: 36% mana arcane_charge(2), arcane_power, rune_of_power
2:21.873 aoe q arcane_explosion Fluffy_Pillow 22146.0/63371: 35% mana arcane_charge(3), arcane_power, rune_of_power
2:23.178 shared_cds t use_mana_gem Kyrian 21300.0/63371: 34% mana arcane_charge(4), arcane_power, rune_of_power
2:23.178 aoe r arcane_barrage Fluffy_Pillow 27637.2/63371: 44% mana arcane_charge(4), arcane_power, rune_of_power
2:24.482 aoe p arcane_orb Fluffy_Pillow 31824.8/63371: 50% mana arcane_power, rune_of_power
2:25.791 aoe r arcane_barrage Fluffy_Pillow 33233.8/63371: 52% mana arcane_charge(4), arcane_power, rune_of_power
2:27.099 aoe q arcane_explosion Fluffy_Pillow 37426.5/63371: 59% mana arcane_power, rune_of_power
2:28.405 aoe q arcane_explosion Fluffy_Pillow 36581.7/63371: 58% mana arcane_charge, arcane_power, rune_of_power
2:29.712 aoe q arcane_explosion Fluffy_Pillow 35738.3/63371: 56% mana arcane_charge(2), arcane_power, rune_of_power
2:31.020 aoe q arcane_explosion Fluffy_Pillow 34896.1/63371: 55% mana arcane_charge(3), arcane_power, rune_of_power
2:32.327 aoe r arcane_barrage Fluffy_Pillow 34052.6/63371: 54% mana arcane_charge(4)
2:33.633 aoe q arcane_explosion Fluffy_Pillow 38242.7/63371: 60% mana
2:34.940 aoe q arcane_explosion Fluffy_Pillow 34899.3/63371: 55% mana arcane_charge
2:36.246 aoe q arcane_explosion Fluffy_Pillow 31554.5/63371: 50% mana arcane_charge(2)
2:37.555 aoe q arcane_explosion Fluffy_Pillow 28213.6/63371: 45% mana arcane_charge(3)
2:38.860 aoe r arcane_barrage Fluffy_Pillow 24867.6/63371: 39% mana arcane_charge(4)
2:40.166 aoe q arcane_explosion Fluffy_Pillow 29057.7/63371: 46% mana
2:41.472 aoe q arcane_explosion Fluffy_Pillow 25713.0/63371: 41% mana arcane_charge
2:42.779 aoe q arcane_explosion Fluffy_Pillow 22369.5/63371: 35% mana arcane_charge(2)
2:44.085 aoe q arcane_explosion Fluffy_Pillow 19024.7/63371: 30% mana arcane_charge(3)
2:45.392 aoe r arcane_barrage Fluffy_Pillow 15681.3/63371: 25% mana arcane_charge(4), clearcasting
2:46.700 aoe k radiant_spark Fluffy_Pillow 19873.9/63371: 31% mana clearcasting
2:48.008 aoe m touch_of_the_magi Fluffy_Pillow 20531.7/63371: 32% mana clearcasting
2:49.314 aoe o rune_of_power Fluffy_Pillow 19687.0/63371: 31% mana arcane_charge(4), clearcasting
2:50.622 aoe r arcane_barrage Fluffy_Pillow 21344.8/63371: 34% mana arcane_charge(4), clearcasting, rune_of_power
2:51.928 aoe p arcane_orb Fluffy_Pillow 25534.9/63371: 40% mana clearcasting, rune_of_power
2:53.235 aoe r arcane_barrage Fluffy_Pillow 26691.4/63371: 42% mana arcane_charge(4), clearcasting, rune_of_power
2:54.542 aoe q arcane_explosion Fluffy_Pillow 30882.8/63371: 49% mana clearcasting, rune_of_power
2:55.849 aoe q arcane_explosion Fluffy_Pillow 32539.3/63371: 51% mana arcane_charge, rune_of_power
2:57.155 aoe q arcane_explosion Fluffy_Pillow 29194.6/63371: 46% mana arcane_charge(2), rune_of_power
2:58.461 aoe q arcane_explosion Fluffy_Pillow 25849.9/63371: 41% mana arcane_charge(3), rune_of_power
2:59.767 aoe r arcane_barrage Fluffy_Pillow 22505.1/63371: 36% mana arcane_charge(4), rune_of_power
3:01.072 aoe q arcane_explosion Fluffy_Pillow 26694.0/63371: 42% mana rune_of_power
3:02.378 aoe q arcane_explosion Fluffy_Pillow 23349.2/63371: 37% mana arcane_charge, rune_of_power
3:03.686 aoe q arcane_explosion Fluffy_Pillow 20007.0/63371: 32% mana arcane_charge(2), rune_of_power
3:04.991 aoe q arcane_explosion Fluffy_Pillow 16661.0/63371: 26% mana arcane_charge(3), clearcasting, rune_of_power
3:06.298 aoe r arcane_barrage Fluffy_Pillow 18317.6/63371: 29% mana arcane_charge(4)
3:07.606 aoe q arcane_explosion Fluffy_Pillow 22510.2/63371: 36% mana
3:08.912 aoe q arcane_explosion Fluffy_Pillow 19165.5/63371: 30% mana arcane_charge
3:10.220 aoe q arcane_explosion Fluffy_Pillow 15823.3/63371: 25% mana arcane_charge(2)
3:11.526 aoe q arcane_explosion Fluffy_Pillow 12478.5/63371: 20% mana arcane_charge(3)
3:12.833 aoe r arcane_barrage Fluffy_Pillow 9135.1/63371: 14% mana arcane_charge(4)
3:14.140 aoe p arcane_orb Fluffy_Pillow 13326.5/63371: 21% mana
3:15.446 aoe r arcane_barrage Fluffy_Pillow 14481.7/63371: 23% mana arcane_charge(4)
3:16.753 aoe q arcane_explosion Fluffy_Pillow 18673.1/63371: 29% mana
3:18.059 aoe j radiant_spark Fluffy_Pillow 15328.4/63371: 24% mana arcane_charge
3:19.366 aoe q arcane_explosion Fluffy_Pillow 15984.9/63371: 25% mana arcane_charge
3:20.672 aoe q arcane_explosion Fluffy_Pillow 12640.2/63371: 20% mana arcane_charge(2)
3:21.979 aoe q arcane_explosion Fluffy_Pillow 9296.7/63371: 15% mana arcane_charge(3)
3:23.285 aoe r arcane_barrage Fluffy_Pillow 5951.9/63371: 9% mana arcane_charge(4)
3:24.590 aoe q arcane_explosion Fluffy_Pillow 10140.8/63371: 16% mana
3:25.896 aoe q arcane_explosion Fluffy_Pillow 6796.1/63371: 11% mana arcane_charge
3:27.202 aoe s evocation Kyrian 3451.3/63371: 5% mana arcane_charge(2)
3:31.547 aoe q arcane_explosion Fluffy_Pillow 57297.3/63371: 90% mana arcane_charge(2)
3:32.854 aoe q arcane_explosion Fluffy_Pillow 53953.8/63371: 85% mana arcane_charge(3)
3:34.160 aoe r arcane_barrage Fluffy_Pillow 50609.0/63371: 80% mana arcane_charge(4)
3:35.465 aoe m touch_of_the_magi Fluffy_Pillow 54797.9/63371: 86% mana
3:36.771 aoe o rune_of_power Fluffy_Pillow 53953.2/63371: 85% mana arcane_charge(4)
3:38.077 aoe r arcane_barrage Fluffy_Pillow 55608.4/63371: 88% mana arcane_charge(4), rune_of_power
3:39.386 aoe p arcane_orb Fluffy_Pillow 59802.3/63371: 94% mana rune_of_power
3:40.692 aoe r arcane_barrage Fluffy_Pillow 60957.6/63371: 96% mana arcane_charge(4), rune_of_power
3:41.998 aoe q arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana rune_of_power
3:43.304 aoe q arcane_explosion Fluffy_Pillow 60026.7/63371: 95% mana arcane_charge, clearcasting, rune_of_power
3:44.611 aoe q arcane_explosion Fluffy_Pillow 61683.2/63371: 97% mana arcane_charge(2), rune_of_power
3:45.918 aoe q arcane_explosion Fluffy_Pillow 58339.7/63371: 92% mana arcane_charge(3), rune_of_power
3:47.225 aoe r arcane_barrage Fluffy_Pillow 54996.3/63371: 87% mana arcane_charge(4), rune_of_power
3:48.530 aoe q arcane_explosion Fluffy_Pillow 59185.1/63371: 93% mana rune_of_power
3:49.837 aoe j radiant_spark Fluffy_Pillow 55841.7/63371: 88% mana arcane_charge, rune_of_power
3:51.144 aoe q arcane_explosion Fluffy_Pillow 56498.2/63371: 89% mana arcane_charge, rune_of_power
3:52.452 aoe q arcane_explosion Fluffy_Pillow 53156.0/63371: 84% mana arcane_charge(2), clearcasting, rune_of_power
3:53.760 aoe q arcane_explosion Fluffy_Pillow 54813.8/63371: 86% mana arcane_charge(3)
3:55.067 aoe r arcane_barrage Fluffy_Pillow 51470.3/63371: 81% mana arcane_charge(4)
3:56.374 aoe q arcane_explosion Fluffy_Pillow 55661.7/63371: 88% mana
3:57.678 aoe q arcane_explosion Fluffy_Pillow 52314.4/63371: 83% mana arcane_charge
3:58.987 aoe q arcane_explosion Fluffy_Pillow 48973.5/63371: 77% mana arcane_charge(2), clearcasting
4:00.293 aoe q arcane_explosion Fluffy_Pillow 50628.7/63371: 80% mana arcane_charge(3)
4:01.598 aoe r arcane_barrage Fluffy_Pillow 47282.7/63371: 75% mana arcane_charge(4)
4:02.905 aoe p arcane_orb Fluffy_Pillow 51474.1/63371: 81% mana
4:04.211 aoe r arcane_barrage Fluffy_Pillow 52629.4/63371: 83% mana arcane_charge(4)
4:05.518 aoe q arcane_explosion Fluffy_Pillow 56820.8/63371: 90% mana
4:06.822 aoe q arcane_explosion Fluffy_Pillow 53473.5/63371: 84% mana arcane_charge
4:08.128 aoe q arcane_explosion Fluffy_Pillow 50128.8/63371: 79% mana arcane_charge(2)
4:09.435 aoe q arcane_explosion Fluffy_Pillow 46785.3/63371: 74% mana arcane_charge(3)
4:10.743 aoe r arcane_barrage Fluffy_Pillow 43443.1/63371: 69% mana arcane_charge(4)
4:12.049 aoe q arcane_explosion Fluffy_Pillow 47633.2/63371: 75% mana
4:13.355 aoe q arcane_explosion Fluffy_Pillow 44288.5/63371: 70% mana arcane_charge
4:14.660 aoe q arcane_explosion Fluffy_Pillow 40942.5/63371: 65% mana arcane_charge(2)
4:15.969 aoe q arcane_explosion Fluffy_Pillow 37601.5/63371: 59% mana arcane_charge(3)
4:17.275 aoe r arcane_barrage Fluffy_Pillow 34256.8/63371: 54% mana arcane_charge(4), clearcasting
4:18.582 aoe q arcane_explosion Fluffy_Pillow 38448.2/63371: 61% mana clearcasting
4:19.887 aoe q arcane_explosion Fluffy_Pillow 40102.2/63371: 63% mana arcane_charge
4:21.194 aoe q arcane_explosion Fluffy_Pillow 36758.7/63371: 58% mana arcane_charge(2), clearcasting
4:22.502 aoe q arcane_explosion Fluffy_Pillow 38416.5/63371: 61% mana arcane_charge(3)
4:23.809 shared_cds t use_mana_gem Kyrian 35073.0/63371: 55% mana arcane_charge(4)
4:23.809 aoe r arcane_barrage Fluffy_Pillow 41410.2/63371: 65% mana arcane_charge(4)
4:25.113 aoe k radiant_spark Fluffy_Pillow 45597.8/63371: 72% mana
4:26.421 aoe m touch_of_the_magi Fluffy_Pillow 46255.6/63371: 73% mana
4:27.725 aoe n arcane_power Fluffy_Pillow 45408.3/63371: 72% mana arcane_charge(4)
4:27.725 shared_cds v berserking Fluffy_Pillow 45408.3/63371: 72% mana arcane_charge(4), arcane_power, rune_of_power
4:27.725 aoe r arcane_barrage Fluffy_Pillow 45408.3/63371: 72% mana berserking, arcane_charge(4), arcane_power, rune_of_power
4:28.914 aoe p arcane_orb Fluffy_Pillow 49450.1/63371: 78% mana berserking, arcane_power, rune_of_power
4:30.103 aoe r arcane_barrage Fluffy_Pillow 50707.1/63371: 80% mana berserking, arcane_charge(4), arcane_power, rune_of_power
4:31.291 aoe q arcane_explosion Fluffy_Pillow 54747.6/63371: 86% mana berserking, arcane_power, rune_of_power
4:32.478 aoe q arcane_explosion Fluffy_Pillow 53752.1/63371: 85% mana berserking, arcane_charge, arcane_power, rune_of_power
4:33.667 aoe q arcane_explosion Fluffy_Pillow 52759.1/63371: 83% mana berserking, arcane_charge(2), arcane_power, rune_of_power
4:34.856 aoe q arcane_explosion Fluffy_Pillow 51766.0/63371: 82% mana berserking, arcane_charge(3), arcane_power, rune_of_power
4:36.043 aoe r arcane_barrage Fluffy_Pillow 50770.5/63371: 80% mana berserking, arcane_charge(4), arcane_power, rune_of_power
4:37.234 aoe q arcane_explosion Fluffy_Pillow 54814.8/63371: 86% mana berserking, arcane_power, rune_of_power
4:38.423 aoe q arcane_explosion Fluffy_Pillow 53821.8/63371: 85% mana berserking, arcane_charge, arcane_power, clearcasting, rune_of_power
4:39.611 aoe q arcane_explosion Fluffy_Pillow 55327.5/63371: 87% mana berserking, arcane_charge(2), arcane_power, rune_of_power
4:40.799 aoe q arcane_explosion Fluffy_Pillow 54333.2/63371: 86% mana arcane_charge(3), arcane_power, clearcasting, rune_of_power
4:42.107 aoe r arcane_barrage Fluffy_Pillow 55991.0/63371: 88% mana arcane_charge(4), arcane_power, rune_of_power
4:43.412 aoe q arcane_explosion Fluffy_Pillow 60179.9/63371: 95% mana
4:44.718 aoe q arcane_explosion Fluffy_Pillow 56835.1/63371: 90% mana arcane_charge
4:46.024 aoe q arcane_explosion Fluffy_Pillow 53490.4/63371: 84% mana arcane_charge(2)
4:47.330 aoe q arcane_explosion Fluffy_Pillow 50145.6/63371: 79% mana arcane_charge(3)
4:48.636 aoe o rune_of_power Fluffy_Pillow 46800.9/63371: 74% mana arcane_charge(4)
4:49.943 aoe r arcane_barrage Fluffy_Pillow 48457.4/63371: 76% mana arcane_charge(4), rune_of_power
4:51.251 aoe p arcane_orb Fluffy_Pillow 52650.1/63371: 83% mana rune_of_power
4:52.560 aoe r arcane_barrage Fluffy_Pillow 53809.2/63371: 85% mana arcane_charge(4), rune_of_power
4:53.866 aoe q arcane_explosion Fluffy_Pillow 57999.3/63371: 92% mana rune_of_power
4:55.172 aoe q arcane_explosion Fluffy_Pillow 54654.5/63371: 86% mana arcane_charge, clearcasting, rune_of_power
4:56.478 aoe j radiant_spark Fluffy_Pillow 56309.8/63371: 89% mana arcane_charge(2), rune_of_power
4:57.785 aoe q arcane_explosion Fluffy_Pillow 56966.3/63371: 90% mana arcane_charge(2), rune_of_power
4:59.091 aoe q arcane_explosion Fluffy_Pillow 53621.6/63371: 85% mana arcane_charge(3), rune_of_power
5:00.398 aoe r arcane_barrage Fluffy_Pillow 50278.1/63371: 79% mana arcane_charge(4), clearcasting, rune_of_power
5:01.704 aoe q arcane_explosion Fluffy_Pillow 54468.2/63371: 86% mana clearcasting, rune_of_power
5:03.010 aoe q arcane_explosion Fluffy_Pillow 56123.5/63371: 89% mana arcane_charge, rune_of_power
5:04.315 aoe q arcane_explosion Fluffy_Pillow 52777.5/63371: 83% mana arcane_charge(2), rune_of_power
5:05.621 aoe q arcane_explosion Fluffy_Pillow 49432.8/63371: 78% mana arcane_charge(3)
5:06.927 aoe r arcane_barrage Fluffy_Pillow 46088.0/63371: 73% mana arcane_charge(4)
5:08.234 aoe q arcane_explosion Fluffy_Pillow 50279.4/63371: 79% mana
5:09.541 aoe q arcane_explosion Fluffy_Pillow 46935.9/63371: 74% mana arcane_charge, clearcasting
5:10.847 aoe q arcane_explosion Fluffy_Pillow 48591.2/63371: 77% mana arcane_charge(2)
5:12.153 aoe q arcane_explosion Fluffy_Pillow 45246.5/63371: 71% mana arcane_charge(3)
5:13.460 aoe r arcane_barrage Fluffy_Pillow 41903.0/63371: 66% mana arcane_charge(4)
5:14.767 aoe p arcane_orb Fluffy_Pillow 46094.4/63371: 73% mana
5:16.074 aoe r arcane_barrage Fluffy_Pillow 47250.9/63371: 75% mana arcane_charge(4)
5:17.380 aoe q arcane_explosion Fluffy_Pillow 51441.0/63371: 81% mana
5:18.687 aoe q arcane_explosion Fluffy_Pillow 48097.5/63371: 76% mana arcane_charge
5:19.994 aoe q arcane_explosion Fluffy_Pillow 44754.1/63371: 71% mana arcane_charge(2)
5:21.301 aoe q arcane_explosion Fluffy_Pillow 41410.6/63371: 65% mana arcane_charge(3), clearcasting
5:22.607 aoe r arcane_barrage Fluffy_Pillow 43065.9/63371: 68% mana arcane_charge(4)
5:23.913 aoe q arcane_explosion Fluffy_Pillow 47256.0/63371: 75% mana
5:25.220 aoe q arcane_explosion Fluffy_Pillow 43912.5/63371: 69% mana arcane_charge
5:26.527 aoe q arcane_explosion Fluffy_Pillow 40569.0/63371: 64% mana arcane_charge(2)
5:27.835 aoe q arcane_explosion Fluffy_Pillow 37226.8/63371: 59% mana arcane_charge(3)
5:29.141 aoe r arcane_barrage Fluffy_Pillow 33882.1/63371: 53% mana arcane_charge(4)
5:30.449 aoe q arcane_explosion Fluffy_Pillow 38074.8/63371: 60% mana
5:31.755 aoe q arcane_explosion Fluffy_Pillow 34730.0/63371: 55% mana arcane_charge
5:33.061 aoe q arcane_explosion Fluffy_Pillow 31385.3/63371: 50% mana arcane_charge(2), clearcasting

Stats

Level Bonus (60) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 198 1 199 199 0
Agility 306 2 308 308 0
Stamina 414 0 434 414 0
Intellect 450 -3 2453 2247 1800
Spirit 0 0 0 0 0
Health 8680 8280 0
Mana 63371 63371 0
Spell Power 2453 2247 0
Crit 19.29% 19.29% 500
Haste 15.15% 15.15% 500
Versatility 12.50% 12.50% 500
Mana Regen 1267 1267 0
Mastery 26.74% 26.74% 500
Armor 0 0 0
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 0.00

Profile

mage="Kyrian"
source=default
spec=arcane
level=60
race=troll
role=spell
position=back
talents=1032021
covenant=kyrian

# Default consumables
potion=deathly_fixation
flask=spectral_flask_of_power
food=feast_of_gluttonous_hedonism
augmentation=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=variable,name=prepull_evo,op=reset,default=0
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
actions.precombat+=/variable,name=have_opened,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
actions.precombat+=/variable,name=final_burn,op=set,value=0
actions.precombat+=/variable,name=rs_max_delay,op=reset,default=5
actions.precombat+=/variable,name=ap_max_delay,op=reset,default=10
actions.precombat+=/variable,name=rop_max_delay,op=reset,default=20
actions.precombat+=/variable,name=totm_max_delay,op=reset,default=5
actions.precombat+=/variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
actions.precombat+=/variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
actions.precombat+=/variable,name=barrage_mana_pct,op=reset,default=70
actions.precombat+=/variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=reset,default=30
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
actions.precombat+=/variable,name=totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=aoe_totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=am_spam,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
actions.precombat+=/variable,name=am_spam_evo_pct,op=reset,default=15
actions.precombat+=/flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/arcane_familiar
actions.precombat+=/arcane_intellect
actions.precombat+=/conjure_mana_gem
actions.precombat+=/snapshot_stats
actions.precombat+=/mirror_image
actions.precombat+=/frostbolt,if=variable.prepull_evo<=0
actions.precombat+=/evocation,if=variable.prepull_evo>0

# Executed every time the actor is available.
actions=counterspell,if=target.debuff.casting.react
actions+=/call_action_list,name=shared_cds
actions+=/call_action_list,name=essences
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/call_action_list,name=opener,if=variable.have_opened<=0
actions+=/call_action_list,name=am_spam,if=variable.am_spam=1
actions+=/call_action_list,name=cooldowns
actions+=/call_action_list,name=rotation,if=variable.final_burn=0
actions+=/call_action_list,name=final_burn,if=variable.final_burn=1
actions+=/call_action_list,name=movement

actions.am_spam=cancel_action,if=action.evocation.channeling&mana.pct>=95
actions.am_spam+=/evocation,if=mana.pct<=variable.am_spam_evo_pct&(cooldown.touch_of_the_magi.remains<=action.evocation.execute_time|cooldown.arcane_power.remains<=action.evocation.execute_time|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=action.evocation.execute_time))&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/rune_of_power,if=buff.rune_of_power.down&cooldown.arcane_power.remains>0
actions.am_spam+=/touch_of_the_magi,if=(cooldown.arcane_power.remains=0&buff.rune_of_power.down)|prev_gcd.1.rune_of_power
actions.am_spam+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&buff.rune_of_power.down&essence.vision_of_perfection.enabled
actions.am_spam+=/arcane_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.ap_max_delay
actions.am_spam+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=action.arcane_missiles.execute_time&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_barrage,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_missiles,if=buff.clearcasting.react,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/arcane_missiles,if=!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/evocation,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.am_spam+=/arcane_barrage
actions.am_spam+=/arcane_blast

actions.aoe=frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
actions.aoe+=/arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
actions.aoe+=/mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
actions.aoe+=/arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
actions.aoe+=/rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
actions.aoe+=/presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
actions.aoe+=/arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
actions.aoe+=/supernova
actions.aoe+=/arcane_orb,if=buff.arcane_charge.stack=0
actions.aoe+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
actions.aoe+=/arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1

# Prioritize using grisly icicle with ap. Use it with totm otherwise.
actions.cooldowns=frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.cooldowns+=/frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/fire_blast,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt
# Always use mirrors with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/mirrors_of_torment,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/mirrors_of_torment,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Always use deathborne with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/deathborne,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/deathborne,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use spark if totm and ap are on cd and won't be up for longer than the max delay, making sure we have at least two arcane charges and that totm wasn't just used.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack>2&debuff.touch_of_the_magi.down
# Use spark with ap when possible. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/radiant_spark,if=cooldown.arcane_power.remains=0&((!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct)
actions.cooldowns+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&essence.vision_of_perfection.minor
# Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken. Hold a bit to make sure we can RS immediately after totm ends
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8
# Non-Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken.
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
# Use ap if totm is on cd and won't be up for longer than the max delay, making sure that we have enough mana and that there is not already a rune of power down.
actions.cooldowns+=/arcane_power,if=(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use rop if totm is on cd and won't be up for longer than the max delay, making sure there isn't already a rune down and that ap won't become available during rune.
actions.cooldowns+=/rune_of_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.rop_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
# Kyrian: RS is mana hungry and AB4s are too expensive to use pom to squeeze an extra ab in the totm window. Let's use it to make low charge ABs instant.
actions.cooldowns+=/presence_of_mind,if=buff.arcane_charge.stack=0&covenant.kyrian.enabled
# Non-Kyrian: Use pom to squeeze an extra ab in the totm window.
actions.cooldowns+=/presence_of_mind,if=debuff.touch_of_the_magi.up&!covenant.kyrian.enabled

actions.essences=blood_of_the_enemy,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/blood_of_the_enemy,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains>=50&cooldown.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay
actions.essences+=/worldvein_resonance,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/guardian_of_azeroth,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/guardian_of_azeroth,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/concentrated_flame,line_cd=6,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/reaping_flames,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/focused_azerite_beam,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/purifying_blast,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/ripple_in_space,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/the_unbound_force,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/memory_of_lucid_dreams,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down

actions.final_burn=arcane_missiles,if=buff.clearcasting.react,chain=1
actions.final_burn+=/arcane_blast
actions.final_burn+=/arcane_barrage

actions.movement=blink_any,if=movement.distance>=10
actions.movement+=/presence_of_mind
actions.movement+=/arcane_missiles,if=movement.distance<10
actions.movement+=/arcane_orb
actions.movement+=/fire_blast

actions.opener=variable,name=have_opened,op=set,value=1,if=prev_gcd.1.evocation
actions.opener+=/fire_blast,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command_frost.up
actions.opener+=/frost_nova,if=runeforge.grisly_icicle.equipped&mana.pct>95
actions.opener+=/mirrors_of_torment
actions.opener+=/deathborne
actions.opener+=/radiant_spark,if=mana.pct>40
actions.opener+=/cancel_action,if=action.shifting_power.channeling&gcd.remains=0
actions.opener+=/shifting_power,if=soulbind.field_of_blossoms.enabled
actions.opener+=/touch_of_the_magi
actions.opener+=/arcane_power
actions.opener+=/rune_of_power,if=buff.rune_of_power.down
actions.opener+=/presence_of_mind
actions.opener+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.opener+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.opener+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.opener+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.opener+=/arcane_missiles,if=buff.clearcasting.react,chain=1
actions.opener+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges&(cooldown.arcane_power.remains>10|active_enemies<=2)
actions.opener+=/arcane_blast,if=buff.rune_of_power.up|mana.pct>15
actions.opener+=/evocation,if=buff.rune_of_power.down,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.opener+=/arcane_barrage

actions.rotation=variable,name=final_burn,op=set,value=1,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&!buff.rule_of_threes.up&fight_remains<=((mana%action.arcane_blast.cost)*action.arcane_blast.execute_time)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&cooldown.arcane_power.remains<=gcd)
actions.rotation+=/strict_sequence,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&buff.arcane_power.down&buff.rune_of_power.down,name=last_spark_stack:arcane_blast:arcane_barrage
actions.rotation+=/arcane_barrage,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&(buff.arcane_power.down|buff.arcane_power.remains<=gcd)&(buff.rune_of_power.down|buff.rune_of_power.remains<=gcd)
actions.rotation+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.rotation+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.rotation+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&(debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time|cooldown.presence_of_mind.remains>0|covenant.kyrian.enabled)&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.expanded_potential.up
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&(buff.arcane_power.up|buff.rune_of_power.up|debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.stack=buff.clearcasting.max_stack,chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.remains<=((buff.clearcasting.stack*action.arcane_missiles.execute_time)+gcd),chain=1
actions.rotation+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges
actions.rotation+=/supernova,if=mana.pct<=95&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.evocation.remains>0&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.rotation+=/arcane_blast,if=buff.rule_of_threes.up&buff.arcane_charge.stack>3
actions.rotation+=/arcane_barrage,if=mana.pct<variable.barrage_mana_pct&cooldown.evocation.remains>0&buff.arcane_power.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&essence.vision_of_perfection.minor
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(cooldown.rune_of_power.remains=0|cooldown.arcane_power.remains=0)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=mana.pct<=variable.barrage_mana_pct&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&talent.arcane_orb.enabled&cooldown.arcane_orb.remains<=gcd&mana.pct<=90&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.rune_of_power.up&buff.rune_of_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_blast
actions.rotation+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.rotation+=/arcane_barrage

actions.shared_cds=use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
actions.shared_cds+=/use_items,if=buff.arcane_power.up
actions.shared_cds+=/potion,if=buff.arcane_power.up
actions.shared_cds+=/time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
actions.shared_cds+=/lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/berserking,if=buff.arcane_power.up
actions.shared_cds+=/blood_fury,if=buff.arcane_power.up
actions.shared_cds+=/fireblood,if=buff.arcane_power.up
actions.shared_cds+=/ancestral_call,if=buff.arcane_power.up


# Gear Summary
# gear_ilvl=0.00
# gear_intellect=1800
# gear_crit_rating=500
# gear_haste_rating=500
# gear_mastery_rating=500
# gear_versatility_rating=500

Necrolord : 11524 dps, 5008 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
11524.4 11524.4 21.7 / 0.188% 1193.8 / 10.4% 5.3
RPS Out RPS In Primary Resource Waiting APM Active Skill
2173.5 2064.8 Mana 0.00% 49.2 100.0% 100%
Talents
Necrolord

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Necrolord 11524
Arcane Barrage 3161 27.4% 49.8 5.68sec 19107 14951 Direct 149.1 5353 10676 6379 19.3%

Stats Details: Arcane Barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 49.78 149.12 0.00 0.00 1.2780 0.0000 951085.62 951085.62 0.00% 14951.36 14951.36
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.73% 120.38 91 159 5353.23 1153 27654 5354.24 4845 6090 644328 644328 0.00%
crit 19.27% 28.73 10 49 10676.21 2307 55308 10683.74 7463 15964 306757 306757 0.00%

Action Details: Arcane Barrage

  • id:44425
  • school:arcane
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:3.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.728000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:44425
  • name:Arcane Barrage
  • school:arcane
  • tooltip:
  • description:Launches bolts of arcane energy at the enemy target, causing {$s1=0 + 72.8%} Arcane damage. For each Arcane Charge, deals {$36032s2=30}% additional damage$?a321526[, grants you {$321526s1=2}% of your maximum mana,][]$?a231564[ and hits {$36032s3=0} additional nearby $Ltarget:targets; for {$s2=40}% of its damage][]. |cFFFFFFFFConsumes all Arcane Charges.|r

Action Priority List

    aoe
    [r]:49.59
  • if_expr:buff.arcane_charge.stack=buff.arcane_charge.max_stack
    rotation
    [u]:0.01
  • if_expr:cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled)
    rotation
    [x]:0.16
Arcane Blast 2703 23.6% 29.8 8.55sec 27470 25591 Direct 86.0 7950 15986 9501 19.3%

Stats Details: Arcane Blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 29.77 86.05 0.00 0.00 1.0734 0.0000 817842.05 817842.05 0.00% 25591.15 25591.15
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.69% 69.43 36 89 7949.85 841 12036 7957.91 6786 8597 552051 552051 0.00%
crit 19.31% 16.61 3 32 15986.40 1682 24073 15999.97 11219 21529 265791 265791 0.00%

Action Details: Arcane Blast

  • id:30451
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1375.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.457000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:30451
  • name:Arcane Blast
  • school:arcane
  • tooltip:
  • description:Blasts the target with energy, dealing {$30451s1=0 + 45.7%} Arcane damage. Each Arcane Charge increases damage by {$36032s1=60}% and mana cost by {$36032s5=100}%, and reduces cast time by {$36032s4=8}%. |cFFFFFFFFGenerates 1 Arcane Charge.|r

Action Priority List

    aoe
    [o]:29.88
  • if_expr:buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
    rotation
    [w]:0.12
Arcane Echo 249 2.2% 37.9 7.49sec 1974 0 Direct 113.8 552 1106 658 19.1%

Stats Details: Arcane Echo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 37.93 113.79 0.00 0.00 0.0000 0.0000 74864.21 74864.21 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.88% 92.03 60 119 552.31 443 731 551.73 508 585 50810 50810 0.00%
crit 19.12% 21.76 9 39 1105.99 886 1462 1104.57 920 1318 24054 24054 0.00%

Action Details: Arcane Echo

  • id:342232
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.109200
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:342232
  • name:Arcane Echo
  • school:arcane
  • tooltip:
  • description:{$@spelldesc342231=Direct damage you deal to enemies affected by Touch of the Magi, causes an explosion that deals {$342232s1=0 + 10.9%} Arcane damage to {$s1=8} nearby enemies.}
Arcane Explosion 3966 34.4% 129.6 2.13sec 9202 7209 Direct 388.8 2569 5150 3068 19.3%

Stats Details: Arcane Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 129.61 388.83 0.00 0.00 1.2764 0.0000 1192649.94 1192649.94 0.00% 7209.26 7209.26
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.67% 313.67 252 393 2568.69 2128 4469 2569.65 2488 2653 805623 805623 0.00%
crit 19.33% 75.16 47 110 5149.93 4256 8938 5151.50 4733 5581 387027 387027 0.00%

Action Details: Arcane Explosion

  • id:1449
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:5000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.546000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:1449
  • name:Arcane Explosion
  • school:arcane
  • tooltip:
  • description:Causes an explosion of magic around the caster, dealing {$s2=0 + 54.6%} Arcane damage to all enemies within $A2 yards.$?a137021[ |cFFFFFFFFGenerates {$s1=1} Arcane Charge if any targets are hit.|r][]

Action Priority List

    aoe
    [q]:129.56
  • if_expr:buff.arcane_charge.stack<buff.arcane_charge.max_stack
Arcane Orb 0 (684) 0.0% (5.9%) 11.6 25.02sec 17824 13920

Stats Details: Arcane Orb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 11.56 0.00 0.00 0.00 1.2806 0.0000 0.00 0.00 0.00% 13919.65 13919.65

Action Details: Arcane Orb

  • id:153626
  • school:arcane
  • range:40.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Spelldata

  • id:153626
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r

Action Priority List

    aoe
    [p]:11.55
  • if_expr:buff.arcane_charge.stack=0
    rotation
    [v]:0.01
  • if_expr:buff.arcane_charge.stack<=variable.totm_max_charges
    Arcane Orb (_bolt) 684 5.9% 34.6 25.03sec 5951 0 Direct 34.6 5000 10027 5952 19.0%

Stats Details: Arcane Orb Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 34.63 34.63 0.00 0.00 0.0000 0.0000 206094.36 206094.36 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.05% 28.07 16 40 4999.53 3869 8126 5005.02 4359 5509 140289 140289 0.00%
crit 18.95% 6.56 0 16 10027.04 7739 16251 10023.45 0 16251 65805 65805 0.00%

Action Details: Arcane Orb Bolt

  • id:153640
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.092000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:153640
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:{$@spelldesc153626=Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r}
Deathly Fixation 0 (63) 0.0% (0.5%) 13.5 1.82sec 1391 0

Stats Details: Deathly Fixation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 13.49 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Deathly Fixation

  • id:322253
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:42.90
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:322253
  • name:Deathly Fixation
  • school:shadow
  • tooltip:Taking $w1 Shadow damage every $t1.
  • description:Deal {$s1=43} Shadow damage every $t1. Stacks up to 5 times.
    Deathly Eruption 63 0.5% 13.5 1.82sec 1391 0 Direct 13.5 1164 2327 1390 19.5%

Stats Details: Deathly Eruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 13.49 13.49 0.00 0.00 0.0000 0.0000 18759.64 18759.64 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.48% 10.86 5 17 1163.53 1164 1164 1163.53 1164 1164 12632 12632 0.00%
crit 19.52% 2.63 0 9 2327.06 2327 2327 2196.68 0 2327 6128 6128 0.00%

Action Details: Deathly Eruption

  • id:322256
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:984.99
  • base_dd_max:984.99
  • base_dd_mult:1.00

Spelldata

  • id:322256
  • name:Deathly Eruption
  • school:shadow
  • tooltip:
  • description:Deal {$s1=985} Shadow damage.
Frostbolt 6 0.1% 0.0 0.00sec 0 0 Direct 1.0 1481 2961 1755 18.4%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 1.00 0.00 0.00 0.0000 0.0000 1753.01 1753.01 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.61% 0.82 0 1 1480.68 1481 1481 1208.35 0 1481 1208 1208 0.00%
crit 18.39% 0.18 0 1 2961.35 2961 2961 544.66 0 2961 545 545 0.00%

Action Details: Frostbolt

  • id:116
  • school:frost
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.511000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116
  • name:Frostbolt
  • school:frost
  • tooltip:
  • description:Launches a bolt of frost at the enemy, causing {$228597s1=0} Frost damage and slowing movement speed by {$205708s1=50}% for {$205708d=8 seconds}.
Mirror Image 0 (20) 0.0% (0.2%) 1.0 0.00sec 6034 0

Stats Details: Mirror Image

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Mirror Image

  • id:55342
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:55342
  • name:Mirror Image
  • school:arcane
  • tooltip:Damage taken is reduced by {$s3=20}% while your images are active.
  • description:Creates {$s2=3} copies of you nearby for {$55342d=40 seconds}, which cast spells and attack your enemies. While your images are active damage taken is reduced by {$s3=20}%, taking direct damage will cause one of your images to dissipate.
    Frostbolt (mirror_image) 151  / 20 0.2% 90.0 1.29sec 67 51 Direct 90.0 56 112 67 19.3%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 90.00 90.00 0.00 0.00 1.3087 0.0000 6034.35 6034.35 0.00% 51.23 51.23
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.74% 72.67 61 83 56.23 43 60 56.23 55 58 4086 4086 0.00%
crit 19.26% 17.33 7 29 112.41 86 120 112.45 101 120 1948 1948 0.00%

Action Details: Frostbolt

  • id:59638
  • school:frost
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.027000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:59638
  • name:Frostbolt
  • school:frost
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for {$d=4 seconds}.

Action Priority List

    default
    [ ]:31.00
Touch of the Magi 0 (672) 0.0% (5.8%) 6.1 52.44sec 32924 26178

Stats Details: Touch Of The Magi

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.15 0.00 0.00 0.00 1.2577 0.0000 0.00 0.00 0.00% 26178.46 26178.46

Action Details: Touch Of The Magi

  • id:321507
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:4.0

Spelldata

  • id:321507
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]

Action Priority List

    aoe
    [k]:6.16
  • if_expr:buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
    Touch of the Magi (_explosion) 672 5.8% 6.1 52.34sec 32924 0 Direct 18.4 11019 0 11019 0.0%

Stats Details: Touch Of The Magi Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.15 18.38 0.00 0.00 0.0000 0.0000 202437.99 202437.99 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 18.38 15 21 11018.89 1843 47512 11012.60 7508 15004 202438 202438 0.00%

Action Details: Touch Of The Magi Explosion

  • id:210833
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:16823.22
  • base_dd_max:16823.22
  • base_dd_mult:1.00

Spelldata

  • id:210833
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:{$@spelldesc321507=Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]}
Simple Action Stats Execute Interval
Necrolord
Arcane Power 2.8 129.36sec

Stats Details: Arcane Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.84 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Arcane Power

  • id:12042
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:12042
  • name:Arcane Power
  • school:arcane
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].

Action Priority List

    aoe
    [l]:2.84
  • if_expr:((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
Berserking 1.8 258.68sec

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.84 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    shared_cds
    [{]:1.84
  • if_expr:buff.arcane_power.up
Conjure Mana Gem 1.0 0.00sec

Stats Details: Conjure Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Conjure Mana Gem

  • id:759
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:9000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:759
  • name:Conjure Mana Gem
  • school:arcane
  • tooltip:
  • description:Conjures a Mana Gem that can be used to instantly restore {$5405s1=10}% mana, and holds up to {$s2=3} charges. $@spellname118812 {$@spelldesc118812=Conjured items disappear if logged out for more than 15 minutes.}
Deathborne 1.8 258.78sec

Stats Details: Deathborne

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.84 0.00 0.00 0.00 1.3065 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Deathborne

  • id:324220
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:324220
  • name:Deathborne
  • school:shadow
  • tooltip:Transformed into a powerful skeletal mage, greatly enhancing your Frostbolt, Fireball, and Arcane Blast and increasing your spell damage by {$s2=10}%.
  • description:Transform into a powerful skeletal mage for {$d=20 seconds}. While in the form of a skeletal mage, your Frostbolt, Fireball, and Arcane Blast hit up to {$s4=2} enemies near your target and your spell damage is increased by {$s2=10}%.

Action Priority List

    aoe
    [j]:1.86
  • if_expr:cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
Evocation 2.1 172.53sec

Stats Details: Evocation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.06 0.00 12.26 0.00 4.0373 0.6764 0.00 0.00 0.00% 0.00 0.00

Action Details: Evocation

  • id:12051
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Necrolord
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:12051
  • name:Evocation
  • school:arcane
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.

Action Priority List

    aoe
    [s]:2.06
  • interrupt_if_expr:mana.pct>=85
Spectral Flask of Power (flask) 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:307185
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Necrolord
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of Gluttonous Hedonism (food) 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:308462
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Necrolord
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Potion of Deathly Fixation (potion) 1.0 0.00sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:307497
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    shared_cds
    [z]:1.00
  • if_expr:buff.arcane_power.up
Presence of Mind 1.8 257.47sec

Stats Details: Presence Of Mind

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.81 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Presence Of Mind

  • id:205025
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:60.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:205025
  • name:Presence of Mind
  • school:arcane
  • tooltip:Arcane Blast is instant cast.
  • description:Causes your next $n Arcane Blasts to be instant cast.

Action Priority List

    aoe
    [n]:1.81
  • if_expr:buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
    cooldowns
    [t]:0.00
  • if_expr:debuff.touch_of_the_magi.up&!covenant.kyrian.enabled
Rune of Power 6.0 51.20sec

Stats Details: Rune Of Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.96 0.00 0.00 0.00 1.2562 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Rune Of Power

  • id:116011
  • school:arcane
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:116011
  • name:Rune of Power
  • school:arcane
  • tooltip:
  • description:Places a Rune of Power on the ground for {$116011d=15 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.

Action Priority List

    aoe
    [m]:5.99
  • if_expr:buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
Replenish Mana (use_mana_gem) 2.9 121.18sec

Stats Details: Use Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.95 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Use Mana Gem

  • id:5405
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Necrolord
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5405
  • name:Replenish Mana
  • school:physical
  • tooltip:Restoring $w2 mana every $t1 sec.
  • description:Restores {$s1=10}% mana.

Action Priority List

    shared_cds
    [y]:2.95
  • if_expr:(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Arcane Charge 50.5 161.2 5.9sec 1.4sec 4.5sec 75.68% 0.00% 29.0 (29.2) 0.0

Buff Details

  • buff initial source:Necrolord
  • cooldown name:buff_arcane_charge
  • max_stacks:4
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:2.0s / 30.9s
  • trigger_min/max:0.0s / 8.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 29.6s

Stack Uptimes

  • arcane_charge_1:16.83%
  • arcane_charge_2:14.76%
  • arcane_charge_3:14.93%
  • arcane_charge_4:29.16%

Spelldata

  • id:36032
  • name:Arcane Charge
  • tooltip:Increases the damage of Arcane Blast, Arcane Missiles, Arcane Explosion, and Arcane Barrage by $36032w1%. Increases the mana cost of Arcane Blast by $36032w2%$?{$w5<0}[, and reduces the cast time of Arcane Blast by $w5%.][.] Increases the number of targets hit by Arcane Barrage for 50% damage by $36032w3.
  • description:$@spelldesc114664
  • max_stacks:4
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Arcane Power 2.8 0.0 129.4sec 129.4sec 14.7sec 13.82% 0.00% 0.0 (0.0) 2.7

Buff Details

  • buff initial source:Necrolord
  • cooldown name:buff_arcane_power
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:121.9s / 134.6s
  • trigger_min/max:121.9s / 134.6s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 15.0s

Stack Uptimes

  • arcane_power_1:13.82%

Spelldata

  • id:12042
  • name:Arcane Power
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
Berserking 1.8 0.0 258.7sec 258.7sec 11.7sec 7.09% 32.56% 0.0 (0.0) 1.7

Buff Details

  • buff initial source:Necrolord
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:253.3s / 263.8s
  • trigger_min/max:253.3s / 263.8s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 12.0s

Stack Uptimes

  • berserking_1:7.09%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.45% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Necrolord
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.45%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Clearcasting 22.5 3.5 13.1sec 11.3sec 3.2sec 23.81% 0.00% 1.1 (1.1) 0.3

Buff Details

  • buff initial source:Necrolord
  • cooldown name:buff_clearcasting
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stack Uptimes

  • clearcasting_1:17.79%
  • clearcasting_2:2.99%
  • clearcasting_3:3.02%

Spelldata

  • id:263725
  • name:Clearcasting
  • tooltip:Your next Arcane Missiles or Arcane Explosion costs no mana{$?s321758=false}[ and Arcane Missiles fires an additional missile][].
  • description:{$@spelldesc79684=For each ${$c*100/{$s1=200}} mana you spend, you have a 1% chance to gain Clearcasting, making your next Arcane Missiles or Arcane Explosion free and channel {$277726s1=20}% faster.$?a321758[ Arcane Missiles fires {$321758s2=1} additional missile.][]}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Deathborne 1.8 0.0 258.8sec 258.8sec 19.1sec 11.58% 0.00% 0.0 (0.0) 1.7

Buff Details

  • buff initial source:Necrolord
  • cooldown name:buff_deathborne
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:254.3s / 263.5s
  • trigger_min/max:254.3s / 263.5s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 20.0s

Stack Uptimes

  • deathborne_1:11.58%

Spelldata

  • id:324220
  • name:Deathborne
  • tooltip:Transformed into a powerful skeletal mage, greatly enhancing your Frostbolt, Fireball, and Arcane Blast and increasing your spell damage by {$s2=10}%.
  • description:Transform into a powerful skeletal mage for {$d=20 seconds}. While in the form of a skeletal mage, your Frostbolt, Fireball, and Arcane Blast hit up to {$s4=2} enemies near your target and your spell damage is increased by {$s2=10}%.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Evocation 2.1 0.0 173.4sec 173.4sec 4.0sec 2.74% 0.00% 8.2 (8.2) 0.0

Buff Details

  • buff initial source:Necrolord
  • cooldown name:buff_evocation
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:7.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:1.00

Trigger Details

  • interval_min/max:90.0s / 283.1s
  • trigger_min/max:90.0s / 283.1s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 4.3s

Stack Uptimes

  • evocation_1:2.74%

Spelldata

  • id:12051
  • name:Evocation
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Deathly Fixation 1.0 0.0 0.0sec 0.0sec 25.0sec 8.40% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Necrolord
  • cooldown name:buff_potion_of_deathly_fixation
  • max_stacks:1
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:25.0s / 25.0s

Stack Uptimes

  • potion_of_deathly_fixation_1:8.40%

Spelldata

  • id:307497
  • name:Potion of Deathly Fixation
  • tooltip:Chance to apply Deathly Fixation to your target.
  • description:Your damaging spells and abilities have a chance to apply Deathly Fixation to your target, dealing {$322253s1=43} Shadow damage over {$322253d=8 seconds} and stacking up to 5 times. Upon reaching 5 stacks, Deathly Fixation explodes, dealing {$322256s1=985} Shadow damage to the target. If you consume this potion while your weapon is augmented with Shadowcore Oil, the explosion damage is increased by {$s2=10}%. Lasts {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Presence of Mind 1.8 0.0 257.1sec 257.1sec 2.3sec 1.36% 18.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Necrolord
  • cooldown name:buff_presence_of_mind
  • max_stacks:3
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:110.6s / 263.1s
  • trigger_min/max:110.6s / 263.1s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 141.4s

Stack Uptimes

  • presence_of_mind_1:0.62%
  • presence_of_mind_2:0.62%
  • presence_of_mind_3:0.12%

Spelldata

  • id:205025
  • name:Presence of Mind
  • tooltip:Arcane Blast is instant cast.
  • description:Causes your next $n Arcane Blasts to be instant cast.
  • max_stacks:0
  • duration:-0.00
  • cooldown:60.00
  • default_chance:100.00%
Rune of Power 8.8 0.0 35.5sec 35.5sec 14.7sec 42.87% 0.00% 0.0 (0.0) 8.4

Buff Details

  • buff initial source:Necrolord
  • cooldown name:buff_rune_of_power
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.40
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:15.7s / 53.3s
  • trigger_min/max:15.7s / 53.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • rune_of_power_1:42.87%

Spelldata

  • id:116014
  • name:Rune of Power
  • tooltip:Spell damage increased by $w1%.$?$w2=0[][ Health restored by $w2% per second.]
  • description:{$@spelldesc116011=Places a Rune of Power on the ground for {$116011d=15 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Well Fed (feast_of_gluttonous_hedonism)

Buff Details

  • buff initial source:Necrolord
  • cooldown name:buff_feast_of_gluttonous_hedonism
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327708
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=20}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Spectral Flask of Power

Buff Details

  • buff initial source:Necrolord
  • cooldown name:buff_spectral_flask_of_power
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:307185
  • name:Spectral Flask of Power
  • tooltip:$pri increased by $w1.
  • description:Increases $pri by {$s1=70} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs, Uptimes & Benefits

Benefit Avg % Min Max
Arcane Barrage Arcane Charge 1 0.03% 0.00% 2.27%
Arcane Barrage Arcane Charge 2 0.11% 0.00% 5.66%
Arcane Barrage Arcane Charge 3 0.17% 0.00% 5.88%
Arcane Barrage Arcane Charge 4 99.68% 89.66% 100.00%
Arcane Blast Arcane Charge 0 1.21% 0.00% 7.41%
Arcane Blast Arcane Charge 1 1.06% 0.00% 7.14%
Arcane Blast Arcane Charge 2 0.94% 0.00% 8.11%
Arcane Blast Arcane Charge 3 0.54% 0.00% 6.67%
Arcane Blast Arcane Charge 4 96.25% 73.33% 100.00%
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 0.50% 0.14% 2.54% 0.7s 0.0s 3.9s
Conserve Phase 100.00% 100.00% 100.00% 301.4s 240.2s 359.7s

Cooldown waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Mirror Image0.0000.0000.000181.465120.158239.654
Evocation63.9950.000193.078152.44269.076251.867
Rune of Power6.8420.06550.10942.95023.11477.073
Touch of the Magi5.4270.00025.29535.09321.80754.647
Arcane Power6.9011.92914.55419.92111.63926.150
Arcane Barrage3.4640.00328.294175.181134.519210.845
Arcane Orb6.5420.01234.53177.82351.577104.458
Deathborne35.5580.00082.23676.28158.85682.236
Presence of Mind91.8227.900201.259205.54559.264235.431

Burn Phases

Burn phase duration tracks the amount of time spent in each burn phase. This is defined as the time between a start_burn_phase and stop_burn_phase action being executed. Note that "execute" burn phases, i.e., the final burn of a fight, is also included.

Burn Phase Duration
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Mana at burn start is the mana level recorded (in percentage of total mana) when a start_burn_phase command is executed.

Mana at Burn Start
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
Necrolord
mana_regen Mana 826.01 379202.15 60.93% 459.08 2297.53 0.60%
Evocation Mana 92.40 99406.79 15.97% 1075.80 0.00 0.00%
Mana Gem Mana 2.95 18685.86 3.00% 6337.14 0.00 0.00%
Arcane Barrage Mana 49.76 125041.52 20.09% 2512.96 916.20 0.73%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 62371.4 2064.84 2173.51 3203.6 30611.7 234.3 63371.4
Usage Type Count Total Avg RPE APR
Necrolord
arcane_blast Mana 29.8 119367.9 4001.2 4009.4 6.9
arcane_explosion Mana 129.6 509372.8 3931.5 3930.1 2.3
arcane_orb Mana 11.6 5527.2 478.4 478.0 37.3
deathborne Mana 1.8 4617.7 2500.0 2504.0 0.0
touch_of_the_magi Mana 6.1 15364.4 2500.0 2498.8 13.2

Statistics & Data Analysis

Fight Length
Necrolord Fight Length
Count 821
Mean 301.46
Minimum 240.16
Maximum 359.65
Spread ( max - min ) 119.50
Range [ ( max - min ) / 2 * 100% ] 19.82%
DPS
Necrolord Damage Per Second
Count 821
Mean 11524.39
Minimum 10762.58
Maximum 12352.33
Spread ( max - min ) 1589.75
Range [ ( max - min ) / 2 * 100% ] 6.90%
Standard Deviation 316.6132
5th Percentile 11022.17
95th Percentile 12074.55
( 95th Percentile - 5th Percentile ) 1052.38
Mean Distribution
Standard Deviation 11.0499
95.00% Confidence Interval ( 11502.73 - 11546.04 )
Normalized 95.00% Confidence Interval ( 99.81% - 100.19% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 29
0.1% Error 2900
0.1 Scale Factor Error with Delta=300 856
0.05 Scale Factor Error with Delta=300 3423
0.01 Scale Factor Error with Delta=300 85574
Priority Target DPS
Necrolord Priority Target Damage Per Second
Count 821
Mean 5007.84
Minimum 4544.45
Maximum 5684.14
Spread ( max - min ) 1139.68
Range [ ( max - min ) / 2 * 100% ] 11.38%
Standard Deviation 186.6990
5th Percentile 4721.76
95th Percentile 5322.46
( 95th Percentile - 5th Percentile ) 600.70
Mean Distribution
Standard Deviation 6.5158
95.00% Confidence Interval ( 4995.07 - 5020.61 )
Normalized 95.00% Confidence Interval ( 99.74% - 100.26% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 54
0.1% Error 5340
0.1 Scale Factor Error with Delta=300 298
0.05 Scale Factor Error with Delta=300 1191
0.01 Scale Factor Error with Delta=300 29756
DPS(e)
Necrolord Damage Per Second (Effective)
Count 821
Mean 11524.39
Minimum 10762.58
Maximum 12352.33
Spread ( max - min ) 1589.75
Range [ ( max - min ) / 2 * 100% ] 6.90%
Damage
Necrolord Damage
Count 821
Mean 3465486.82
Minimum 2708040.07
Maximum 4216576.13
Spread ( max - min ) 1508536.06
Range [ ( max - min ) / 2 * 100% ] 21.77%
DTPS
Necrolord Damage Taken Per Second
Count 821
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Necrolord Healing Per Second
Count 821
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Necrolord Healing Per Second (Effective)
Count 821
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Necrolord Heal
Count 821
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Necrolord Healing Taken Per Second
Count 821
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Necrolord Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
NecrolordTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Necrolord Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 variable,name=prepull_evo,op=reset,default=0
1 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
2 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
3 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
4 0.00 variable,name=have_opened,op=reset,default=0
5 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
6 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
7 0.00 variable,name=final_burn,op=set,value=0
8 0.00 variable,name=rs_max_delay,op=reset,default=5
9 0.00 variable,name=ap_max_delay,op=reset,default=10
A 0.00 variable,name=rop_max_delay,op=reset,default=20
B 0.00 variable,name=totm_max_delay,op=reset,default=5
C 0.00 variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
D 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
E 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
F 0.00 variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
G 0.00 variable,name=barrage_mana_pct,op=reset,default=70
H 0.00 variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
I 0.00 variable,name=ap_minimum_mana_pct,op=reset,default=30
J 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
K 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
L 0.00 variable,name=totm_max_charges,op=reset,default=2
M 0.00 variable,name=aoe_totm_max_charges,op=reset,default=2
N 0.00 variable,name=am_spam,op=reset,default=0
O 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
P 0.00 variable,name=am_spam_evo_pct,op=reset,default=15
Q 0.00 flask
R 0.00 food
S 0.00 augmentation
T 0.00 arcane_familiar
U 0.00 arcane_intellect
V 0.00 conjure_mana_gem
W 0.00 snapshot_stats
X 0.00 mirror_image
Y 0.00 frostbolt,if=variable.prepull_evo<=0
Z 0.00 evocation,if=variable.prepull_evo>0
Default action list Executed every time the actor is available.
# count action,conditions
0.00 counterspell,if=target.debuff.casting.react
a 0.00 call_action_list,name=shared_cds
b 0.00 call_action_list,name=essences
c 0.00 call_action_list,name=aoe,if=active_enemies>2
d 0.00 call_action_list,name=opener,if=variable.have_opened<=0
e 0.00 call_action_list,name=am_spam,if=variable.am_spam=1
f 0.00 call_action_list,name=cooldowns
g 0.00 call_action_list,name=rotation,if=variable.final_burn=0
h 0.00 call_action_list,name=final_burn,if=variable.final_burn=1
i 0.00 call_action_list,name=movement
actions.aoe
# count action,conditions
0.00 frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
0.00 arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
0.00 mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
j 1.86 deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
k 6.16 touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
l 2.84 arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
m 5.99 rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
n 1.81 presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
o 29.88 arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
0.00 supernova
p 11.55 arcane_orb,if=buff.arcane_charge.stack=0
0.00 nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
0.00 shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
q 129.56 arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
0.00 arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
r 49.59 arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
s 2.06 evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.rotation
# count action,conditions
0.00 variable,name=final_burn,op=set,value=1,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&!buff.rule_of_threes.up&fight_remains<=((mana%action.arcane_blast.cost)*action.arcane_blast.execute_time)
0.00 arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8)
u 0.01 arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled)
0.00 arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)
0.00 arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&cooldown.arcane_power.remains<=gcd)
0.00 strict_sequence,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&buff.arcane_power.down&buff.rune_of_power.down,name=last_spark_stack:arcane_blast:arcane_barrage
0.00 arcane_barrage,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&(buff.arcane_power.down|buff.arcane_power.remains<=gcd)&(buff.rune_of_power.down|buff.rune_of_power.remains<=gcd)
0.00 arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
0.00 arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
0.00 arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&(debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time|cooldown.presence_of_mind.remains>0|covenant.kyrian.enabled)&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
0.00 arcane_missiles,if=buff.clearcasting.react&buff.expanded_potential.up
0.00 arcane_missiles,if=buff.clearcasting.react&(buff.arcane_power.up|buff.rune_of_power.up|debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time),chain=1
0.00 arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.stack=buff.clearcasting.max_stack,chain=1
0.00 arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.remains<=((buff.clearcasting.stack*action.arcane_missiles.execute_time)+gcd),chain=1
0.00 nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.arcane_power.down&debuff.touch_of_the_magi.down
v 0.01 arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges
0.00 supernova,if=mana.pct<=95&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
0.00 shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.evocation.remains>0&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
0.00 arcane_blast,if=buff.rule_of_threes.up&buff.arcane_charge.stack>3
0.00 arcane_barrage,if=mana.pct<variable.barrage_mana_pct&cooldown.evocation.remains>0&buff.arcane_power.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&essence.vision_of_perfection.minor
0.00 arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(cooldown.rune_of_power.remains=0|cooldown.arcane_power.remains=0)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
0.00 arcane_barrage,if=mana.pct<=variable.barrage_mana_pct&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&cooldown.evocation.remains>0
0.00 arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&talent.arcane_orb.enabled&cooldown.arcane_orb.remains<=gcd&mana.pct<=90&cooldown.evocation.remains>0
0.00 arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
0.00 arcane_barrage,if=buff.rune_of_power.up&buff.rune_of_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
0.00 arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
w 0.12 arcane_blast
0.00 evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
x 0.16 arcane_barrage
actions.shared_cds
# count action,conditions
y 2.95 use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
0.00 use_items,if=buff.arcane_power.up
z 1.00 potion,if=buff.arcane_power.up
0.00 time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
0.00 lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
0.00 bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
{ 1.84 berserking,if=buff.arcane_power.up
0.00 blood_fury,if=buff.arcane_power.up
0.00 fireblood,if=buff.arcane_power.up
0.00 ancestral_call,if=buff.arcane_power.up

Sample Sequence

045789ABGILMNPQRVXYjklz{oooyooonoooooooooomooorprqqqqrqqqqrqqqqrqqsqqrprqqqqrqqqqrkmrqqqqrprqqqqrqqqqrqqqqrprqqqqrqqqqrkmrqqqqrpyrqqqqlrqqqqrqqqqrprqqqqrqqqqrkmrqqqqrprqqqqrqqqqrqqqqrprqqqqrqqqsqrkmrprqqqqrqqqqrqqqqrprqqyqqrqqqqrqqqqrjkl{oooonooooooooomoorprqqqqrqwsqqrprqqqqrqqqqrqqqqrkmr

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 prepull_evo Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 4 have_opened Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 5 have_opened Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 7 final_burn Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 8 rs_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 9 ap_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat A rop_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat B totm_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat G barrage_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat I ap_minimum_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat L totm_max_charges Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat M aoe_totm_max_charges Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat N am_spam Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat P am_spam_evo_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat Q flask Necrolord 63371.4/63371: 100% mana
Pre precombat R food Necrolord 63371.4/63371: 100% mana
Pre precombat V conjure_mana_gem Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat X mirror_image Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat Y frostbolt Fluffy_Pillow 63371.4/63371: 100% mana
0:00.000 aoe j deathborne Fluffy_Pillow 62371.4/63371: 98% mana
0:01.308 aoe k touch_of_the_magi Fluffy_Pillow 60879.0/63371: 96% mana bloodlust, deathborne
0:02.314 aoe l arcane_power Fluffy_Pillow 59654.1/63371: 94% mana bloodlust, arcane_charge(4), deathborne
0:02.314 shared_cds z potion Fluffy_Pillow 59654.1/63371: 94% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, deathborne
0:02.314 shared_cds { berserking Fluffy_Pillow 59654.1/63371: 94% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, deathborne, potion_of_deathly_fixation
0:02.314 aoe o arcane_blast Fluffy_Pillow 59654.1/63371: 94% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, deathborne, potion_of_deathly_fixation
0:03.247 aoe o arcane_blast Fluffy_Pillow 57399.1/63371: 91% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, deathborne, potion_of_deathly_fixation
0:04.178 aoe o arcane_blast Fluffy_Pillow 55141.6/63371: 87% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, deathborne, potion_of_deathly_fixation
0:05.111 shared_cds y use_mana_gem Necrolord 52886.6/63371: 83% mana bloodlust, berserking, arcane_charge(4), arcane_power, clearcasting, rune_of_power, deathborne, potion_of_deathly_fixation
0:05.111 aoe o arcane_blast Fluffy_Pillow 59223.7/63371: 93% mana bloodlust, berserking, arcane_charge(4), arcane_power, clearcasting, rune_of_power, deathborne, potion_of_deathly_fixation
0:06.044 aoe o arcane_blast Fluffy_Pillow 56968.7/63371: 90% mana bloodlust, berserking, arcane_charge(4), arcane_power, clearcasting, rune_of_power, deathborne, potion_of_deathly_fixation
0:06.978 aoe o arcane_blast Fluffy_Pillow 54715.0/63371: 86% mana bloodlust, berserking, arcane_charge(4), arcane_power, clearcasting, rune_of_power, deathborne, potion_of_deathly_fixation
0:07.910 aoe n presence_of_mind Fluffy_Pillow 52458.7/63371: 83% mana bloodlust, berserking, arcane_charge(4), arcane_power, clearcasting(2), rune_of_power, deathborne, potion_of_deathly_fixation
0:07.910 aoe o arcane_blast Fluffy_Pillow 52458.7/63371: 83% mana bloodlust, berserking, arcane_charge(4), arcane_power, clearcasting(2), presence_of_mind(3), rune_of_power, deathborne, potion_of_deathly_fixation
0:08.825 aoe o arcane_blast Fluffy_Pillow 50180.9/63371: 79% mana bloodlust, berserking, arcane_charge(4), arcane_power, clearcasting(3), presence_of_mind(2), rune_of_power, deathborne, potion_of_deathly_fixation
0:09.740 aoe o arcane_blast Fluffy_Pillow 47903.1/63371: 76% mana bloodlust, berserking, arcane_charge(4), arcane_power, clearcasting(3), presence_of_mind, rune_of_power, deathborne, potion_of_deathly_fixation
0:10.653 aoe o arcane_blast Fluffy_Pillow 45622.8/63371: 72% mana bloodlust, berserking, arcane_charge(4), arcane_power, clearcasting(3), rune_of_power, deathborne, potion_of_deathly_fixation
0:11.586 aoe o arcane_blast Fluffy_Pillow 43367.8/63371: 68% mana bloodlust, berserking, arcane_charge(4), arcane_power, clearcasting(3), rune_of_power, deathborne, potion_of_deathly_fixation
0:12.519 aoe o arcane_blast Fluffy_Pillow 41112.8/63371: 65% mana bloodlust, berserking, arcane_charge(4), arcane_power, clearcasting(3), rune_of_power, deathborne, potion_of_deathly_fixation
0:13.452 aoe o arcane_blast Fluffy_Pillow 38857.8/63371: 61% mana bloodlust, berserking, arcane_charge(4), arcane_power, clearcasting(3), rune_of_power, deathborne, potion_of_deathly_fixation
0:14.386 aoe o arcane_blast Fluffy_Pillow 36604.1/63371: 58% mana bloodlust, arcane_charge(4), arcane_power, clearcasting(3), rune_of_power, deathborne, potion_of_deathly_fixation
0:15.413 aoe o arcane_blast Fluffy_Pillow 34468.3/63371: 54% mana bloodlust, arcane_charge(4), arcane_power, clearcasting(3), rune_of_power, deathborne, potion_of_deathly_fixation
0:16.440 aoe o arcane_blast Fluffy_Pillow 32332.4/63371: 51% mana bloodlust, arcane_charge(4), arcane_power, clearcasting(3), rune_of_power, deathborne, potion_of_deathly_fixation
0:17.467 aoe m rune_of_power Fluffy_Pillow 26759.1/63371: 42% mana bloodlust, arcane_charge(4), clearcasting(3), deathborne, potion_of_deathly_fixation
0:18.473 aoe o arcane_blast Fluffy_Pillow 28034.1/63371: 44% mana bloodlust, arcane_charge(4), clearcasting(3), rune_of_power, deathborne, potion_of_deathly_fixation
0:19.501 aoe o arcane_blast Fluffy_Pillow 22462.0/63371: 35% mana bloodlust, arcane_charge(4), clearcasting(3), rune_of_power, deathborne, potion_of_deathly_fixation
0:20.528 aoe o arcane_blast Fluffy_Pillow 16888.7/63371: 27% mana bloodlust, arcane_charge(4), clearcasting(3), rune_of_power, deathborne, potion_of_deathly_fixation
0:21.556 aoe r arcane_barrage Fluffy_Pillow 11316.6/63371: 18% mana bloodlust, arcane_charge(4), clearcasting(3), rune_of_power, potion_of_deathly_fixation
0:22.562 aoe p arcane_orb Fluffy_Pillow 15126.5/63371: 24% mana bloodlust, clearcasting(3), rune_of_power, potion_of_deathly_fixation
0:23.567 aoe r arcane_barrage Fluffy_Pillow 15900.2/63371: 25% mana bloodlust, arcane_charge(4), clearcasting(3), rune_of_power, potion_of_deathly_fixation
0:24.573 aoe q arcane_explosion Fluffy_Pillow 19710.1/63371: 31% mana bloodlust, clearcasting(3), rune_of_power, potion_of_deathly_fixation
0:25.581 aoe q arcane_explosion Fluffy_Pillow 20987.7/63371: 33% mana bloodlust, arcane_charge, clearcasting(2), rune_of_power, potion_of_deathly_fixation
0:26.586 aoe q arcane_explosion Fluffy_Pillow 22261.4/63371: 35% mana bloodlust, arcane_charge(2), clearcasting, rune_of_power, potion_of_deathly_fixation
0:27.591 aoe q arcane_explosion Fluffy_Pillow 23535.2/63371: 37% mana bloodlust, arcane_charge(3), rune_of_power
0:28.598 aoe r arcane_barrage Fluffy_Pillow 19811.5/63371: 31% mana bloodlust, arcane_charge(4), rune_of_power
0:29.604 aoe q arcane_explosion Fluffy_Pillow 23621.4/63371: 37% mana bloodlust, rune_of_power
0:30.609 aoe q arcane_explosion Fluffy_Pillow 19895.2/63371: 31% mana bloodlust, arcane_charge, rune_of_power
0:31.615 aoe q arcane_explosion Fluffy_Pillow 16170.2/63371: 26% mana bloodlust, arcane_charge(2), clearcasting, rune_of_power
0:32.623 aoe q arcane_explosion Fluffy_Pillow 17447.8/63371: 28% mana bloodlust, arcane_charge(3), rune_of_power
0:33.630 aoe r arcane_barrage Fluffy_Pillow 13724.1/63371: 22% mana bloodlust, arcane_charge(4)
0:34.637 aoe q arcane_explosion Fluffy_Pillow 17535.2/63371: 28% mana bloodlust
0:35.644 aoe q arcane_explosion Fluffy_Pillow 13811.5/63371: 22% mana bloodlust, arcane_charge, clearcasting
0:36.652 aoe q arcane_explosion Fluffy_Pillow 15089.1/63371: 24% mana bloodlust, arcane_charge(2)
0:37.660 aoe q arcane_explosion Fluffy_Pillow 11366.7/63371: 18% mana bloodlust, arcane_charge(3)
0:38.666 aoe r arcane_barrage Fluffy_Pillow 7641.7/63371: 12% mana bloodlust, arcane_charge(4)
0:39.673 aoe q arcane_explosion Fluffy_Pillow 11452.9/63371: 18% mana bloodlust
0:40.681 aoe q arcane_explosion Fluffy_Pillow 7730.4/63371: 12% mana bloodlust, arcane_charge
0:41.686 aoe s evocation Necrolord 4004.2/63371: 6% mana arcane_charge(2)
0:46.032 aoe q arcane_explosion Fluffy_Pillow 57851.4/63371: 91% mana arcane_charge(2)
0:47.338 aoe q arcane_explosion Fluffy_Pillow 54506.7/63371: 86% mana arcane_charge(3), clearcasting
0:48.646 aoe r arcane_barrage Fluffy_Pillow 56164.5/63371: 89% mana arcane_charge(4)
0:49.951 aoe p arcane_orb Fluffy_Pillow 60353.3/63371: 95% mana
0:51.259 aoe r arcane_barrage Fluffy_Pillow 61511.1/63371: 97% mana arcane_charge(4)
0:52.565 aoe q arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana
0:53.872 aoe q arcane_explosion Fluffy_Pillow 60028.0/63371: 95% mana arcane_charge
0:55.177 aoe q arcane_explosion Fluffy_Pillow 56682.0/63371: 89% mana arcane_charge(2), clearcasting
0:56.482 aoe q arcane_explosion Fluffy_Pillow 58335.9/63371: 92% mana arcane_charge(3)
0:57.788 aoe r arcane_barrage Fluffy_Pillow 54991.2/63371: 87% mana arcane_charge(4)
0:59.096 aoe q arcane_explosion Fluffy_Pillow 59183.9/63371: 93% mana
1:00.403 aoe q arcane_explosion Fluffy_Pillow 55840.4/63371: 88% mana arcane_charge
1:01.708 aoe q arcane_explosion Fluffy_Pillow 52494.4/63371: 83% mana arcane_charge(2)
1:03.014 aoe q arcane_explosion Fluffy_Pillow 49149.6/63371: 78% mana arcane_charge(3)
1:04.322 aoe r arcane_barrage Fluffy_Pillow 45807.4/63371: 72% mana arcane_charge(4)
1:05.629 aoe k touch_of_the_magi Fluffy_Pillow 49998.8/63371: 79% mana
1:06.935 aoe m rune_of_power Fluffy_Pillow 49154.1/63371: 78% mana arcane_charge(4)
1:08.243 aoe r arcane_barrage Fluffy_Pillow 50811.9/63371: 80% mana arcane_charge(4), rune_of_power
1:09.550 aoe q arcane_explosion Fluffy_Pillow 55003.3/63371: 87% mana rune_of_power
1:10.857 aoe q arcane_explosion Fluffy_Pillow 51659.8/63371: 82% mana arcane_charge, rune_of_power
1:12.164 aoe q arcane_explosion Fluffy_Pillow 48316.3/63371: 76% mana arcane_charge(2), rune_of_power
1:13.472 aoe q arcane_explosion Fluffy_Pillow 44974.1/63371: 71% mana arcane_charge(3), rune_of_power
1:14.778 aoe r arcane_barrage Fluffy_Pillow 41629.4/63371: 66% mana arcane_charge(4), rune_of_power
1:16.085 aoe p arcane_orb Fluffy_Pillow 45820.8/63371: 72% mana rune_of_power
1:17.391 aoe r arcane_barrage Fluffy_Pillow 46976.0/63371: 74% mana arcane_charge(4), rune_of_power
1:18.699 aoe q arcane_explosion Fluffy_Pillow 51168.7/63371: 81% mana rune_of_power
1:20.005 aoe q arcane_explosion Fluffy_Pillow 47824.0/63371: 75% mana arcane_charge, rune_of_power
1:21.312 aoe q arcane_explosion Fluffy_Pillow 44480.5/63371: 70% mana arcane_charge(2), rune_of_power
1:22.620 aoe q arcane_explosion Fluffy_Pillow 41138.3/63371: 65% mana arcane_charge(3), rune_of_power
1:23.924 aoe r arcane_barrage Fluffy_Pillow 37791.0/63371: 60% mana arcane_charge(4), clearcasting
1:25.231 aoe q arcane_explosion Fluffy_Pillow 41982.4/63371: 66% mana clearcasting
1:26.537 aoe q arcane_explosion Fluffy_Pillow 43637.7/63371: 69% mana arcane_charge
1:27.844 aoe q arcane_explosion Fluffy_Pillow 40294.2/63371: 64% mana arcane_charge(2)
1:29.151 aoe q arcane_explosion Fluffy_Pillow 36950.7/63371: 58% mana arcane_charge(3)
1:30.458 aoe r arcane_barrage Fluffy_Pillow 33607.2/63371: 53% mana arcane_charge(4)
1:31.765 aoe q arcane_explosion Fluffy_Pillow 37798.6/63371: 60% mana
1:33.072 aoe q arcane_explosion Fluffy_Pillow 34455.2/63371: 54% mana arcane_charge
1:34.379 aoe q arcane_explosion Fluffy_Pillow 31111.7/63371: 49% mana arcane_charge(2)
1:35.687 aoe q arcane_explosion Fluffy_Pillow 27769.5/63371: 44% mana arcane_charge(3)
1:36.994 aoe r arcane_barrage Fluffy_Pillow 24426.0/63371: 39% mana arcane_charge(4)
1:38.301 aoe p arcane_orb Fluffy_Pillow 28617.4/63371: 45% mana
1:39.606 aoe r arcane_barrage Fluffy_Pillow 29771.4/63371: 47% mana arcane_charge(4)
1:40.912 aoe q arcane_explosion Fluffy_Pillow 33961.5/63371: 54% mana
1:42.218 aoe q arcane_explosion Fluffy_Pillow 30616.8/63371: 48% mana arcane_charge
1:43.523 aoe q arcane_explosion Fluffy_Pillow 27270.8/63371: 43% mana arcane_charge(2)
1:44.828 aoe q arcane_explosion Fluffy_Pillow 23924.8/63371: 38% mana arcane_charge(3)
1:46.134 aoe r arcane_barrage Fluffy_Pillow 20580.0/63371: 32% mana arcane_charge(4)
1:47.442 aoe q arcane_explosion Fluffy_Pillow 24772.7/63371: 39% mana
1:48.747 aoe q arcane_explosion Fluffy_Pillow 21426.7/63371: 34% mana arcane_charge
1:50.053 aoe q arcane_explosion Fluffy_Pillow 18081.9/63371: 29% mana arcane_charge(2)
1:51.359 aoe q arcane_explosion Fluffy_Pillow 14737.2/63371: 23% mana arcane_charge(3)
1:52.666 aoe r arcane_barrage Fluffy_Pillow 11393.7/63371: 18% mana arcane_charge(4)
1:53.973 aoe k touch_of_the_magi Fluffy_Pillow 15585.1/63371: 25% mana
1:55.278 aoe m rune_of_power Fluffy_Pillow 14739.1/63371: 23% mana arcane_charge(4)
1:56.586 aoe r arcane_barrage Fluffy_Pillow 16396.9/63371: 26% mana arcane_charge(4), rune_of_power
1:57.893 aoe q arcane_explosion Fluffy_Pillow 20588.3/63371: 32% mana rune_of_power
1:59.200 aoe q arcane_explosion Fluffy_Pillow 17244.8/63371: 27% mana arcane_charge, rune_of_power
2:00.505 aoe q arcane_explosion Fluffy_Pillow 13898.8/63371: 22% mana arcane_charge(2), clearcasting, rune_of_power
2:01.810 aoe q arcane_explosion Fluffy_Pillow 15552.8/63371: 25% mana arcane_charge(3), rune_of_power
2:03.116 aoe r arcane_barrage Fluffy_Pillow 12208.1/63371: 19% mana arcane_charge(4), clearcasting, rune_of_power
2:04.423 aoe p arcane_orb Fluffy_Pillow 16399.5/63371: 26% mana clearcasting, rune_of_power
2:05.729 shared_cds y use_mana_gem Necrolord 17554.7/63371: 28% mana arcane_charge(4), clearcasting, rune_of_power
2:05.729 aoe r arcane_barrage Fluffy_Pillow 23891.9/63371: 38% mana arcane_charge(4), clearcasting, rune_of_power
2:07.035 aoe q arcane_explosion Fluffy_Pillow 28082.0/63371: 44% mana clearcasting, rune_of_power
2:08.343 aoe q arcane_explosion Fluffy_Pillow 29739.8/63371: 47% mana arcane_charge, rune_of_power
2:09.647 aoe q arcane_explosion Fluffy_Pillow 26392.5/63371: 42% mana arcane_charge(2), rune_of_power
2:10.953 aoe q arcane_explosion Fluffy_Pillow 23047.8/63371: 36% mana arcane_charge(3), rune_of_power
2:12.259 aoe l arcane_power Fluffy_Pillow 19703.0/63371: 31% mana arcane_charge(4)
2:12.259 aoe r arcane_barrage Fluffy_Pillow 19703.0/63371: 31% mana arcane_charge(4), arcane_power, rune_of_power
2:13.566 aoe q arcane_explosion Fluffy_Pillow 23894.4/63371: 38% mana arcane_power, rune_of_power
2:14.872 aoe q arcane_explosion Fluffy_Pillow 23049.7/63371: 36% mana arcane_charge, arcane_power, rune_of_power
2:16.178 aoe q arcane_explosion Fluffy_Pillow 22204.9/63371: 35% mana arcane_charge(2), arcane_power, rune_of_power
2:17.486 aoe q arcane_explosion Fluffy_Pillow 21362.7/63371: 34% mana arcane_charge(3), arcane_power, rune_of_power
2:18.792 aoe r arcane_barrage Fluffy_Pillow 20518.0/63371: 32% mana arcane_charge(4), arcane_power, rune_of_power
2:20.098 aoe q arcane_explosion Fluffy_Pillow 24708.1/63371: 39% mana arcane_power, rune_of_power
2:21.404 aoe q arcane_explosion Fluffy_Pillow 23863.4/63371: 38% mana arcane_charge, arcane_power, rune_of_power
2:22.709 aoe q arcane_explosion Fluffy_Pillow 23017.4/63371: 36% mana arcane_charge(2), arcane_power, rune_of_power
2:24.017 aoe q arcane_explosion Fluffy_Pillow 22175.2/63371: 35% mana arcane_charge(3), arcane_power, rune_of_power
2:25.323 aoe r arcane_barrage Fluffy_Pillow 21330.4/63371: 34% mana arcane_charge(4), arcane_power, rune_of_power
2:26.630 aoe p arcane_orb Fluffy_Pillow 25521.8/63371: 40% mana arcane_power, rune_of_power
2:27.936 aoe r arcane_barrage Fluffy_Pillow 26927.1/63371: 42% mana arcane_charge(4)
2:29.244 aoe q arcane_explosion Fluffy_Pillow 31119.7/63371: 49% mana
2:30.552 aoe q arcane_explosion Fluffy_Pillow 27777.5/63371: 44% mana arcane_charge
2:31.858 aoe q arcane_explosion Fluffy_Pillow 24432.8/63371: 39% mana arcane_charge(2)
2:33.163 aoe q arcane_explosion Fluffy_Pillow 21086.8/63371: 33% mana arcane_charge(3), clearcasting
2:34.469 aoe r arcane_barrage Fluffy_Pillow 22742.0/63371: 36% mana arcane_charge(4)
2:35.776 aoe q arcane_explosion Fluffy_Pillow 26933.4/63371: 43% mana
2:37.081 aoe q arcane_explosion Fluffy_Pillow 23587.4/63371: 37% mana arcane_charge
2:38.388 aoe q arcane_explosion Fluffy_Pillow 20244.0/63371: 32% mana arcane_charge(2)
2:39.694 aoe q arcane_explosion Fluffy_Pillow 16899.2/63371: 27% mana arcane_charge(3), clearcasting
2:41.002 aoe r arcane_barrage Fluffy_Pillow 18557.0/63371: 29% mana arcane_charge(4)
2:42.308 aoe k touch_of_the_magi Fluffy_Pillow 22747.1/63371: 36% mana
2:43.614 aoe m rune_of_power Fluffy_Pillow 21902.4/63371: 35% mana arcane_charge(4)
2:44.920 aoe r arcane_barrage Fluffy_Pillow 23557.7/63371: 37% mana arcane_charge(4), rune_of_power
2:46.226 aoe q arcane_explosion Fluffy_Pillow 27747.8/63371: 44% mana rune_of_power
2:47.533 aoe q arcane_explosion Fluffy_Pillow 24404.3/63371: 39% mana arcane_charge, rune_of_power
2:48.839 aoe q arcane_explosion Fluffy_Pillow 21059.6/63371: 33% mana arcane_charge(2), rune_of_power
2:50.146 aoe q arcane_explosion Fluffy_Pillow 17716.1/63371: 28% mana arcane_charge(3), clearcasting, rune_of_power
2:51.453 aoe r arcane_barrage Fluffy_Pillow 19372.6/63371: 31% mana arcane_charge(4), rune_of_power
2:52.758 aoe p arcane_orb Fluffy_Pillow 23561.5/63371: 37% mana rune_of_power
2:54.063 aoe r arcane_barrage Fluffy_Pillow 24715.5/63371: 39% mana arcane_charge(4), rune_of_power
2:55.369 aoe q arcane_explosion Fluffy_Pillow 28905.6/63371: 46% mana rune_of_power
2:56.675 aoe q arcane_explosion Fluffy_Pillow 25560.8/63371: 40% mana arcane_charge, clearcasting, rune_of_power
2:57.982 aoe q arcane_explosion Fluffy_Pillow 27217.4/63371: 43% mana arcane_charge(2), rune_of_power
2:59.288 aoe q arcane_explosion Fluffy_Pillow 23872.6/63371: 38% mana arcane_charge(3), rune_of_power
3:00.593 aoe r arcane_barrage Fluffy_Pillow 20526.6/63371: 32% mana arcane_charge(4), clearcasting
3:01.899 aoe q arcane_explosion Fluffy_Pillow 24716.7/63371: 39% mana clearcasting
3:03.206 aoe q arcane_explosion Fluffy_Pillow 26373.3/63371: 42% mana arcane_charge
3:04.514 aoe q arcane_explosion Fluffy_Pillow 23031.1/63371: 36% mana arcane_charge(2)
3:05.820 aoe q arcane_explosion Fluffy_Pillow 19686.3/63371: 31% mana arcane_charge(3)
3:07.127 aoe r arcane_barrage Fluffy_Pillow 16342.9/63371: 26% mana arcane_charge(4)
3:08.434 aoe q arcane_explosion Fluffy_Pillow 20534.3/63371: 32% mana
3:09.741 aoe q arcane_explosion Fluffy_Pillow 17190.8/63371: 27% mana arcane_charge
3:11.047 aoe q arcane_explosion Fluffy_Pillow 13846.0/63371: 22% mana arcane_charge(2)
3:12.355 aoe q arcane_explosion Fluffy_Pillow 10503.8/63371: 17% mana arcane_charge(3), clearcasting
3:13.662 aoe r arcane_barrage Fluffy_Pillow 12160.4/63371: 19% mana arcane_charge(4)
3:14.967 aoe p arcane_orb Fluffy_Pillow 16349.2/63371: 26% mana
3:16.274 aoe r arcane_barrage Fluffy_Pillow 17505.7/63371: 28% mana arcane_charge(4)
3:17.581 aoe q arcane_explosion Fluffy_Pillow 21697.1/63371: 34% mana
3:18.888 aoe q arcane_explosion Fluffy_Pillow 18353.7/63371: 29% mana arcane_charge
3:20.194 aoe q arcane_explosion Fluffy_Pillow 15008.9/63371: 24% mana arcane_charge(2)
3:21.502 aoe q arcane_explosion Fluffy_Pillow 11666.7/63371: 18% mana arcane_charge(3)
3:22.807 aoe r arcane_barrage Fluffy_Pillow 8320.7/63371: 13% mana arcane_charge(4)
3:24.113 aoe q arcane_explosion Fluffy_Pillow 12510.8/63371: 20% mana
3:25.421 aoe q arcane_explosion Fluffy_Pillow 9168.6/63371: 14% mana arcane_charge
3:26.726 aoe q arcane_explosion Fluffy_Pillow 5822.6/63371: 9% mana arcane_charge(2)
3:28.031 aoe s evocation Fluffy_Pillow 2476.6/63371: 4% mana arcane_charge(3)
3:32.377 aoe q arcane_explosion Fluffy_Pillow 56323.8/63371: 89% mana arcane_charge(3)
3:33.684 aoe r arcane_barrage Fluffy_Pillow 52980.4/63371: 84% mana arcane_charge(4)
3:34.990 aoe k touch_of_the_magi Fluffy_Pillow 57170.5/63371: 90% mana
3:36.294 aoe m rune_of_power Fluffy_Pillow 56323.2/63371: 89% mana arcane_charge(4)
3:37.602 aoe r arcane_barrage Fluffy_Pillow 57981.0/63371: 91% mana arcane_charge(4), rune_of_power
3:38.909 aoe p arcane_orb Fluffy_Pillow 62172.4/63371: 98% mana rune_of_power
3:40.215 aoe r arcane_barrage Fluffy_Pillow 63327.6/63371: 100% mana arcane_charge(4), rune_of_power
3:41.521 aoe q arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana rune_of_power
3:42.828 aoe q arcane_explosion Fluffy_Pillow 60028.0/63371: 95% mana arcane_charge, rune_of_power
3:44.136 aoe q arcane_explosion Fluffy_Pillow 56685.8/63371: 89% mana arcane_charge(2), rune_of_power
3:45.442 aoe q arcane_explosion Fluffy_Pillow 53341.0/63371: 84% mana arcane_charge(3), rune_of_power
3:46.748 aoe r arcane_barrage Fluffy_Pillow 49996.3/63371: 79% mana arcane_charge(4), rune_of_power
3:48.054 aoe q arcane_explosion Fluffy_Pillow 54186.4/63371: 86% mana rune_of_power
3:49.362 aoe q arcane_explosion Fluffy_Pillow 50844.2/63371: 80% mana arcane_charge, clearcasting, rune_of_power
3:50.668 aoe q arcane_explosion Fluffy_Pillow 52499.5/63371: 83% mana arcane_charge(2), rune_of_power
3:51.974 aoe q arcane_explosion Fluffy_Pillow 49154.7/63371: 78% mana arcane_charge(3), rune_of_power
3:53.279 aoe r arcane_barrage Fluffy_Pillow 45808.7/63371: 72% mana arcane_charge(4)
3:54.586 aoe q arcane_explosion Fluffy_Pillow 50000.1/63371: 79% mana
3:55.892 aoe q arcane_explosion Fluffy_Pillow 46655.4/63371: 74% mana arcane_charge
3:57.198 aoe q arcane_explosion Fluffy_Pillow 43310.6/63371: 68% mana arcane_charge(2), clearcasting
3:58.505 aoe q arcane_explosion Fluffy_Pillow 44967.1/63371: 71% mana arcane_charge(3)
3:59.812 aoe r arcane_barrage Fluffy_Pillow 41623.7/63371: 66% mana arcane_charge(4), clearcasting
4:01.118 aoe p arcane_orb Fluffy_Pillow 45813.8/63371: 72% mana clearcasting
4:02.424 aoe r arcane_barrage Fluffy_Pillow 46969.1/63371: 74% mana arcane_charge(4), clearcasting
4:03.731 aoe q arcane_explosion Fluffy_Pillow 51160.4/63371: 81% mana clearcasting
4:05.037 aoe q arcane_explosion Fluffy_Pillow 52815.7/63371: 83% mana arcane_charge
4:06.345 shared_cds y use_mana_gem Necrolord 49473.5/63371: 78% mana arcane_charge(2)
4:06.345 aoe q arcane_explosion Fluffy_Pillow 55810.6/63371: 88% mana arcane_charge(2)
4:07.652 aoe q arcane_explosion Fluffy_Pillow 52467.2/63371: 83% mana arcane_charge(3)
4:08.959 aoe r arcane_barrage Fluffy_Pillow 49123.7/63371: 78% mana arcane_charge(4)
4:10.265 aoe q arcane_explosion Fluffy_Pillow 53313.8/63371: 84% mana
4:11.572 aoe q arcane_explosion Fluffy_Pillow 49970.4/63371: 79% mana arcane_charge
4:12.879 aoe q arcane_explosion Fluffy_Pillow 46626.9/63371: 74% mana arcane_charge(2)
4:14.185 aoe q arcane_explosion Fluffy_Pillow 43282.1/63371: 68% mana arcane_charge(3)
4:15.490 aoe r arcane_barrage Fluffy_Pillow 39936.1/63371: 63% mana arcane_charge(4)
4:16.797 aoe q arcane_explosion Fluffy_Pillow 44127.5/63371: 70% mana
4:18.104 aoe q arcane_explosion Fluffy_Pillow 40784.1/63371: 64% mana arcane_charge
4:19.410 aoe q arcane_explosion Fluffy_Pillow 37439.3/63371: 59% mana arcane_charge(2)
4:20.717 aoe q arcane_explosion Fluffy_Pillow 34095.8/63371: 54% mana arcane_charge(3), clearcasting
4:22.025 aoe r arcane_barrage Fluffy_Pillow 35753.6/63371: 56% mana arcane_charge(4)
4:23.332 aoe j deathborne Fluffy_Pillow 39945.0/63371: 63% mana
4:24.637 aoe k touch_of_the_magi Fluffy_Pillow 39099.0/63371: 62% mana deathborne
4:25.943 aoe l arcane_power Fluffy_Pillow 38254.3/63371: 60% mana arcane_charge(4), clearcasting, deathborne
4:25.943 shared_cds { berserking Fluffy_Pillow 38254.3/63371: 60% mana arcane_charge(4), arcane_power, clearcasting, rune_of_power, deathborne
4:25.943 aoe o arcane_blast Fluffy_Pillow 38254.3/63371: 60% mana berserking, arcane_charge(4), arcane_power, clearcasting, rune_of_power, deathborne
4:27.156 aoe o arcane_blast Fluffy_Pillow 36354.2/63371: 57% mana berserking, arcane_charge(4), arcane_power, clearcasting, rune_of_power, deathborne
4:28.369 aoe o arcane_blast Fluffy_Pillow 34454.1/63371: 54% mana berserking, arcane_charge(4), arcane_power, clearcasting, rune_of_power, deathborne
4:29.581 aoe o arcane_blast Fluffy_Pillow 32552.7/63371: 51% mana berserking, arcane_charge(4), arcane_power, clearcasting, rune_of_power, deathborne
4:30.791 aoe n presence_of_mind Fluffy_Pillow 30648.8/63371: 48% mana berserking, arcane_charge(4), arcane_power, clearcasting, rune_of_power, deathborne
4:30.791 aoe o arcane_blast Fluffy_Pillow 30648.8/63371: 48% mana berserking, arcane_charge(4), arcane_power, clearcasting, presence_of_mind(3), rune_of_power, deathborne
4:31.979 aoe o arcane_blast Fluffy_Pillow 28717.0/63371: 45% mana berserking, arcane_charge(4), arcane_power, clearcasting(2), presence_of_mind(2), rune_of_power, deathborne
4:33.168 aoe o arcane_blast Fluffy_Pillow 26786.5/63371: 42% mana berserking, arcane_charge(4), arcane_power, clearcasting(2), presence_of_mind, rune_of_power, deathborne
4:34.357 aoe o arcane_blast Fluffy_Pillow 24855.9/63371: 39% mana berserking, arcane_charge(4), arcane_power, clearcasting(2), rune_of_power, deathborne
4:35.568 aoe o arcane_blast Fluffy_Pillow 22953.3/63371: 36% mana berserking, arcane_charge(4), arcane_power, clearcasting(2), rune_of_power, deathborne
4:36.779 aoe o arcane_blast Fluffy_Pillow 21050.6/63371: 33% mana berserking, arcane_charge(4), arcane_power, clearcasting(3), rune_of_power, deathborne
4:37.991 aoe o arcane_blast Fluffy_Pillow 19149.3/63371: 30% mana arcane_charge(4), arcane_power, clearcasting(3), rune_of_power, deathborne
4:39.321 aoe o arcane_blast Fluffy_Pillow 17397.4/63371: 27% mana arcane_charge(4), arcane_power, clearcasting(3), rune_of_power, deathborne
4:40.655 aoe o arcane_blast Fluffy_Pillow 15650.7/63371: 25% mana arcane_charge(4), arcane_power, clearcasting(3), rune_of_power, deathborne
4:41.990 aoe m rune_of_power Fluffy_Pillow 10467.7/63371: 17% mana arcane_charge(4), clearcasting(3), deathborne
4:43.294 aoe o arcane_blast Fluffy_Pillow 12120.4/63371: 19% mana arcane_charge(4), clearcasting(3), rune_of_power, deathborne
4:44.625 aoe o arcane_blast Fluffy_Pillow 6932.4/63371: 11% mana arcane_charge(4), clearcasting(3), rune_of_power, deathborne
4:45.957 aoe r arcane_barrage Fluffy_Pillow 1745.6/63371: 3% mana arcane_charge(4), clearcasting(3), rune_of_power
4:47.265 aoe p arcane_orb Fluffy_Pillow 5938.3/63371: 9% mana clearcasting(3), rune_of_power
4:48.574 aoe r arcane_barrage Fluffy_Pillow 7097.3/63371: 11% mana arcane_charge(4), clearcasting(3), rune_of_power
4:49.881 aoe q arcane_explosion Fluffy_Pillow 11288.7/63371: 18% mana clearcasting(3), rune_of_power
4:51.189 aoe q arcane_explosion Fluffy_Pillow 12946.5/63371: 20% mana arcane_charge, rune_of_power
4:52.496 aoe q arcane_explosion Fluffy_Pillow 9603.0/63371: 15% mana arcane_charge(2), rune_of_power
4:53.801 aoe q arcane_explosion Fluffy_Pillow 6257.0/63371: 10% mana arcane_charge(3), rune_of_power
4:55.107 aoe r arcane_barrage Fluffy_Pillow 2912.3/63371: 5% mana arcane_charge(4), rune_of_power
4:56.413 aoe q arcane_explosion Fluffy_Pillow 7102.4/63371: 11% mana rune_of_power
4:57.722 rotation w arcane_blast Fluffy_Pillow 3761.5/63371: 6% mana arcane_charge, rune_of_power
4:59.522 aoe s evocation Fluffy_Pillow 3292.8/63371: 5% mana arcane_charge(2)
5:03.867 aoe q arcane_explosion Fluffy_Pillow 57138.8/63371: 90% mana arcane_charge(2)
5:05.175 aoe q arcane_explosion Fluffy_Pillow 53796.6/63371: 85% mana arcane_charge(3)
5:06.482 aoe r arcane_barrage Fluffy_Pillow 50453.1/63371: 80% mana arcane_charge(4)
5:07.789 aoe p arcane_orb Fluffy_Pillow 54644.5/63371: 86% mana
5:09.096 aoe r arcane_barrage Fluffy_Pillow 55801.0/63371: 88% mana arcane_charge(4)
5:10.403 aoe q arcane_explosion Fluffy_Pillow 59992.4/63371: 95% mana
5:11.711 aoe q arcane_explosion Fluffy_Pillow 56650.2/63371: 89% mana arcane_charge
5:13.016 aoe q arcane_explosion Fluffy_Pillow 53304.2/63371: 84% mana arcane_charge(2)
5:14.321 aoe q arcane_explosion Fluffy_Pillow 49958.2/63371: 79% mana arcane_charge(3), clearcasting
5:15.627 aoe r arcane_barrage Fluffy_Pillow 51613.4/63371: 81% mana arcane_charge(4)
5:16.934 aoe q arcane_explosion Fluffy_Pillow 55804.8/63371: 88% mana
5:18.240 aoe q arcane_explosion Fluffy_Pillow 52460.1/63371: 83% mana arcane_charge
5:19.546 aoe q arcane_explosion Fluffy_Pillow 49115.4/63371: 78% mana arcane_charge(2), clearcasting
5:20.852 aoe q arcane_explosion Fluffy_Pillow 50770.6/63371: 80% mana arcane_charge(3)
5:22.159 aoe r arcane_barrage Fluffy_Pillow 47427.1/63371: 75% mana arcane_charge(4), clearcasting
5:23.465 aoe q arcane_explosion Fluffy_Pillow 51617.3/63371: 81% mana clearcasting
5:24.773 aoe q arcane_explosion Fluffy_Pillow 53275.1/63371: 84% mana arcane_charge
5:26.080 aoe q arcane_explosion Fluffy_Pillow 49931.6/63371: 79% mana arcane_charge(2)
5:27.386 aoe q arcane_explosion Fluffy_Pillow 46586.9/63371: 74% mana arcane_charge(3), clearcasting
5:28.693 aoe r arcane_barrage Fluffy_Pillow 48243.4/63371: 76% mana arcane_charge(4)
5:30.000 aoe k touch_of_the_magi Fluffy_Pillow 52434.8/63371: 83% mana
5:31.305 aoe m rune_of_power Fluffy_Pillow 51588.8/63371: 81% mana arcane_charge(4)
5:32.611 aoe r arcane_barrage Fluffy_Pillow 53244.0/63371: 84% mana arcane_charge(4), rune_of_power

Stats

Level Bonus (60) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 198 1 199 199 0
Agility 306 2 308 308 0
Stamina 414 0 434 414 0
Intellect 450 -3 2453 2247 1800
Spirit 0 0 0 0 0
Health 8680 8280 0
Mana 63371 63371 0
Spell Power 2453 2247 0
Crit 19.29% 19.29% 500
Haste 15.15% 15.15% 500
Versatility 12.50% 12.50% 500
Mana Regen 1267 1267 0
Mastery 26.74% 26.74% 500
Armor 0 0 0
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 0.00

Profile

mage="Necrolord"
source=default
spec=arcane
level=60
race=troll
role=spell
position=back
talents=1032021
covenant=necrolord

# Default consumables
potion=deathly_fixation
flask=spectral_flask_of_power
food=feast_of_gluttonous_hedonism
augmentation=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=variable,name=prepull_evo,op=reset,default=0
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
actions.precombat+=/variable,name=have_opened,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
actions.precombat+=/variable,name=final_burn,op=set,value=0
actions.precombat+=/variable,name=rs_max_delay,op=reset,default=5
actions.precombat+=/variable,name=ap_max_delay,op=reset,default=10
actions.precombat+=/variable,name=rop_max_delay,op=reset,default=20
actions.precombat+=/variable,name=totm_max_delay,op=reset,default=5
actions.precombat+=/variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
actions.precombat+=/variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
actions.precombat+=/variable,name=barrage_mana_pct,op=reset,default=70
actions.precombat+=/variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=reset,default=30
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
actions.precombat+=/variable,name=totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=aoe_totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=am_spam,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
actions.precombat+=/variable,name=am_spam_evo_pct,op=reset,default=15
actions.precombat+=/flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/arcane_familiar
actions.precombat+=/arcane_intellect
actions.precombat+=/conjure_mana_gem
actions.precombat+=/snapshot_stats
actions.precombat+=/mirror_image
actions.precombat+=/frostbolt,if=variable.prepull_evo<=0
actions.precombat+=/evocation,if=variable.prepull_evo>0

# Executed every time the actor is available.
actions=counterspell,if=target.debuff.casting.react
actions+=/call_action_list,name=shared_cds
actions+=/call_action_list,name=essences
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/call_action_list,name=opener,if=variable.have_opened<=0
actions+=/call_action_list,name=am_spam,if=variable.am_spam=1
actions+=/call_action_list,name=cooldowns
actions+=/call_action_list,name=rotation,if=variable.final_burn=0
actions+=/call_action_list,name=final_burn,if=variable.final_burn=1
actions+=/call_action_list,name=movement

actions.am_spam=cancel_action,if=action.evocation.channeling&mana.pct>=95
actions.am_spam+=/evocation,if=mana.pct<=variable.am_spam_evo_pct&(cooldown.touch_of_the_magi.remains<=action.evocation.execute_time|cooldown.arcane_power.remains<=action.evocation.execute_time|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=action.evocation.execute_time))&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/rune_of_power,if=buff.rune_of_power.down&cooldown.arcane_power.remains>0
actions.am_spam+=/touch_of_the_magi,if=(cooldown.arcane_power.remains=0&buff.rune_of_power.down)|prev_gcd.1.rune_of_power
actions.am_spam+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&buff.rune_of_power.down&essence.vision_of_perfection.enabled
actions.am_spam+=/arcane_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.ap_max_delay
actions.am_spam+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=action.arcane_missiles.execute_time&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_barrage,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_missiles,if=buff.clearcasting.react,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/arcane_missiles,if=!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/evocation,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.am_spam+=/arcane_barrage
actions.am_spam+=/arcane_blast

actions.aoe=frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
actions.aoe+=/arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
actions.aoe+=/mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
actions.aoe+=/arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
actions.aoe+=/rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
actions.aoe+=/presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
actions.aoe+=/arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
actions.aoe+=/supernova
actions.aoe+=/arcane_orb,if=buff.arcane_charge.stack=0
actions.aoe+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
actions.aoe+=/arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1

# Prioritize using grisly icicle with ap. Use it with totm otherwise.
actions.cooldowns=frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.cooldowns+=/frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/fire_blast,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt
# Always use mirrors with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/mirrors_of_torment,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/mirrors_of_torment,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Always use deathborne with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/deathborne,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/deathborne,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use spark if totm and ap are on cd and won't be up for longer than the max delay, making sure we have at least two arcane charges and that totm wasn't just used.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack>2&debuff.touch_of_the_magi.down
# Use spark with ap when possible. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/radiant_spark,if=cooldown.arcane_power.remains=0&((!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct)
actions.cooldowns+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&essence.vision_of_perfection.minor
# Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken. Hold a bit to make sure we can RS immediately after totm ends
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8
# Non-Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken.
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
# Use ap if totm is on cd and won't be up for longer than the max delay, making sure that we have enough mana and that there is not already a rune of power down.
actions.cooldowns+=/arcane_power,if=(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use rop if totm is on cd and won't be up for longer than the max delay, making sure there isn't already a rune down and that ap won't become available during rune.
actions.cooldowns+=/rune_of_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.rop_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
# Kyrian: RS is mana hungry and AB4s are too expensive to use pom to squeeze an extra ab in the totm window. Let's use it to make low charge ABs instant.
actions.cooldowns+=/presence_of_mind,if=buff.arcane_charge.stack=0&covenant.kyrian.enabled
# Non-Kyrian: Use pom to squeeze an extra ab in the totm window.
actions.cooldowns+=/presence_of_mind,if=debuff.touch_of_the_magi.up&!covenant.kyrian.enabled

actions.essences=blood_of_the_enemy,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/blood_of_the_enemy,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains>=50&cooldown.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay
actions.essences+=/worldvein_resonance,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/guardian_of_azeroth,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/guardian_of_azeroth,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/concentrated_flame,line_cd=6,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/reaping_flames,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/focused_azerite_beam,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/purifying_blast,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/ripple_in_space,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/the_unbound_force,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/memory_of_lucid_dreams,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down

actions.final_burn=arcane_missiles,if=buff.clearcasting.react,chain=1
actions.final_burn+=/arcane_blast
actions.final_burn+=/arcane_barrage

actions.movement=blink_any,if=movement.distance>=10
actions.movement+=/presence_of_mind
actions.movement+=/arcane_missiles,if=movement.distance<10
actions.movement+=/arcane_orb
actions.movement+=/fire_blast

actions.opener=variable,name=have_opened,op=set,value=1,if=prev_gcd.1.evocation
actions.opener+=/fire_blast,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command_frost.up
actions.opener+=/frost_nova,if=runeforge.grisly_icicle.equipped&mana.pct>95
actions.opener+=/mirrors_of_torment
actions.opener+=/deathborne
actions.opener+=/radiant_spark,if=mana.pct>40
actions.opener+=/cancel_action,if=action.shifting_power.channeling&gcd.remains=0
actions.opener+=/shifting_power,if=soulbind.field_of_blossoms.enabled
actions.opener+=/touch_of_the_magi
actions.opener+=/arcane_power
actions.opener+=/rune_of_power,if=buff.rune_of_power.down
actions.opener+=/presence_of_mind
actions.opener+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.opener+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.opener+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.opener+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.opener+=/arcane_missiles,if=buff.clearcasting.react,chain=1
actions.opener+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges&(cooldown.arcane_power.remains>10|active_enemies<=2)
actions.opener+=/arcane_blast,if=buff.rune_of_power.up|mana.pct>15
actions.opener+=/evocation,if=buff.rune_of_power.down,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.opener+=/arcane_barrage

actions.rotation=variable,name=final_burn,op=set,value=1,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&!buff.rule_of_threes.up&fight_remains<=((mana%action.arcane_blast.cost)*action.arcane_blast.execute_time)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&cooldown.arcane_power.remains<=gcd)
actions.rotation+=/strict_sequence,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&buff.arcane_power.down&buff.rune_of_power.down,name=last_spark_stack:arcane_blast:arcane_barrage
actions.rotation+=/arcane_barrage,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&(buff.arcane_power.down|buff.arcane_power.remains<=gcd)&(buff.rune_of_power.down|buff.rune_of_power.remains<=gcd)
actions.rotation+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.rotation+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.rotation+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&(debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time|cooldown.presence_of_mind.remains>0|covenant.kyrian.enabled)&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.expanded_potential.up
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&(buff.arcane_power.up|buff.rune_of_power.up|debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.stack=buff.clearcasting.max_stack,chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.remains<=((buff.clearcasting.stack*action.arcane_missiles.execute_time)+gcd),chain=1
actions.rotation+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges
actions.rotation+=/supernova,if=mana.pct<=95&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.evocation.remains>0&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.rotation+=/arcane_blast,if=buff.rule_of_threes.up&buff.arcane_charge.stack>3
actions.rotation+=/arcane_barrage,if=mana.pct<variable.barrage_mana_pct&cooldown.evocation.remains>0&buff.arcane_power.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&essence.vision_of_perfection.minor
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(cooldown.rune_of_power.remains=0|cooldown.arcane_power.remains=0)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=mana.pct<=variable.barrage_mana_pct&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&talent.arcane_orb.enabled&cooldown.arcane_orb.remains<=gcd&mana.pct<=90&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.rune_of_power.up&buff.rune_of_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_blast
actions.rotation+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.rotation+=/arcane_barrage

actions.shared_cds=use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
actions.shared_cds+=/use_items,if=buff.arcane_power.up
actions.shared_cds+=/potion,if=buff.arcane_power.up
actions.shared_cds+=/time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
actions.shared_cds+=/lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/berserking,if=buff.arcane_power.up
actions.shared_cds+=/blood_fury,if=buff.arcane_power.up
actions.shared_cds+=/fireblood,if=buff.arcane_power.up
actions.shared_cds+=/ancestral_call,if=buff.arcane_power.up


# Gear Summary
# gear_ilvl=0.00
# gear_intellect=1800
# gear_crit_rating=500
# gear_haste_rating=500
# gear_mastery_rating=500
# gear_versatility_rating=500

Night_Fae : 11392 dps, 4761 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
11392.0 11392.0 17.2 / 0.151% 963.8 / 8.5% 6.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
1885.5 1785.0 Mana 0.00% 47.9 100.0% 100%
Talents
Night Fae

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Night_Fae 11392
Arcane Barrage 4031 35.4% 54.5 5.55sec 22266 17983 Direct 163.2 6241 12456 7435 19.2%

Stats Details: Arcane Barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 54.48 163.23 0.00 0.00 1.2382 0.0000 1212941.00 1212941.00 0.00% 17982.82 17982.82
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.80% 131.89 99 167 6241.26 2082 25140 6243.30 5507 6989 822704 822704 0.00%
crit 19.20% 31.34 15 53 12456.04 4164 50280 12467.06 8314 17802 390237 390237 0.00%

Action Details: Arcane Barrage

  • id:44425
  • school:arcane
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:3.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.728000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:44425
  • name:Arcane Barrage
  • school:arcane
  • tooltip:
  • description:Launches bolts of arcane energy at the enemy target, causing {$s1=0 + 72.8%} Arcane damage. For each Arcane Charge, deals {$36032s2=30}% additional damage$?a321526[, grants you {$321526s1=2}% of your maximum mana,][]$?a231564[ and hits {$36032s3=0} additional nearby $Ltarget:targets; for {$s2=40}% of its damage][]. |cFFFFFFFFConsumes all Arcane Charges.|r

Action Priority List

    aoe
    [p]:54.48
  • if_expr:buff.arcane_charge.stack=buff.arcane_charge.max_stack
Arcane Echo 289 2.5% 41.5 6.92sec 2096 0 Direct 124.6 586 1172 699 19.2%

Stats Details: Arcane Echo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 41.55 124.64 0.00 0.00 0.0000 0.0000 87061.87 87061.87 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.79% 100.70 67 133 586.02 443 664 585.89 564 611 59002 59002 0.00%
crit 19.21% 23.94 9 45 1171.82 886 1329 1171.89 1021 1329 28060 28060 0.00%

Action Details: Arcane Echo

  • id:342232
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.109200
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:342232
  • name:Arcane Echo
  • school:arcane
  • tooltip:
  • description:{$@spelldesc342231=Direct damage you deal to enemies affected by Touch of the Magi, causes an explosion that deals {$342232s1=0 + 10.9%} Arcane damage to {$s1=8} nearby enemies.}
Arcane Explosion 5060 44.4% 143.2 2.08sec 10643 8556 Direct 429.7 2974 5946 3547 19.3%

Stats Details: Arcane Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 143.24 429.72 0.00 0.00 1.2439 0.0000 1524441.14 1524441.14 0.00% 8556.10 8556.10
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.70% 346.78 272 422 2973.66 2128 4469 2973.57 2883 3096 1031300 1031300 0.00%
crit 19.30% 82.94 46 117 5946.34 4256 8938 5944.45 5381 6475 493141 493141 0.00%

Action Details: Arcane Explosion

  • id:1449
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:5000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.546000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:1449
  • name:Arcane Explosion
  • school:arcane
  • tooltip:
  • description:Causes an explosion of magic around the caster, dealing {$s2=0 + 54.6%} Arcane damage to all enemies within $A2 yards.$?a137021[ |cFFFFFFFFGenerates {$s1=1} Arcane Charge if any targets are hit.|r][]

Action Priority List

    aoe
    [o]:143.21
  • if_expr:buff.arcane_charge.stack<buff.arcane_charge.max_stack
Arcane Orb 0 (883) 0.0% (7.7%) 13.9 22.34sec 19071 15440

Stats Details: Arcane Orb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 13.93 0.00 0.00 0.00 1.2352 0.0000 0.00 0.00 0.00% 15439.86 15439.86

Action Details: Arcane Orb

  • id:153626
  • school:arcane
  • range:40.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Spelldata

  • id:153626
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r

Action Priority List

    aoe
    [m]:13.93
  • if_expr:buff.arcane_charge.stack=0
    Arcane Orb (_bolt) 883 7.7% 41.7 22.34sec 6368 0 Direct 41.7 5333 10693 6368 19.3%

Stats Details: Arcane Orb Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 41.71 41.71 0.00 0.00 0.0000 0.0000 265642.72 265642.72 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.69% 33.66 21 47 5332.66 3869 8126 5340.87 4781 5910 179478 179478 0.00%
crit 19.31% 8.06 2 17 10692.90 7739 16251 10717.88 7739 14549 86164 86164 0.00%

Action Details: Arcane Orb Bolt

  • id:153640
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.092000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:153640
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:{$@spelldesc153626=Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r}
Deathly Fixation 0 (85) 0.0% (0.8%) 18.8 10.30sec 1388 0

Stats Details: Deathly Fixation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 18.78 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Deathly Fixation

  • id:322253
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:42.90
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:322253
  • name:Deathly Fixation
  • school:shadow
  • tooltip:Taking $w1 Shadow damage every $t1.
  • description:Deal {$s1=43} Shadow damage every $t1. Stacks up to 5 times.
    Deathly Eruption 85 0.8% 18.8 10.30sec 1388 0 Direct 18.8 1164 2327 1388 19.3%

Stats Details: Deathly Eruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 18.78 18.78 0.00 0.00 0.0000 0.0000 26078.12 26078.12 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.67% 15.15 6 30 1163.53 1164 1164 1163.53 1164 1164 17629 17629 0.00%
crit 19.33% 3.63 0 11 2327.06 2327 2327 2239.20 0 2327 8449 8449 0.00%

Action Details: Deathly Eruption

  • id:322256
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:984.99
  • base_dd_max:984.99
  • base_dd_mult:1.00

Spelldata

  • id:322256
  • name:Deathly Eruption
  • school:shadow
  • tooltip:
  • description:Deal {$s1=985} Shadow damage.
Frostbolt 6 0.1% 0.0 0.00sec 0 0 Direct 1.0 1481 2961 1769 19.7%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 1.00 0.00 0.00 0.0000 0.0000 1772.84 1772.84 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.27% 0.80 0 1 1480.68 1481 1481 1188.51 0 1481 1189 1189 0.00%
crit 19.73% 0.20 0 1 2961.35 2961 2961 584.34 0 2961 584 584 0.00%

Action Details: Frostbolt

  • id:116
  • school:frost
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.511000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116
  • name:Frostbolt
  • school:frost
  • tooltip:
  • description:Launches a bolt of frost at the enemy, causing {$228597s1=0} Frost damage and slowing movement speed by {$205708s1=50}% for {$205708d=8 seconds}.
Mirror Image 0 (20) 0.0% (0.2%) 1.0 0.00sec 6030 0

Stats Details: Mirror Image

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Mirror Image

  • id:55342
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:55342
  • name:Mirror Image
  • school:arcane
  • tooltip:Damage taken is reduced by {$s3=20}% while your images are active.
  • description:Creates {$s2=3} copies of you nearby for {$55342d=40 seconds}, which cast spells and attack your enemies. While your images are active damage taken is reduced by {$s3=20}%, taking direct damage will cause one of your images to dissipate.
    Frostbolt (mirror_image) 151  / 20 0.2% 90.0 1.29sec 67 51 Direct 90.0 56 112 67 19.2%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 90.00 90.00 0.00 0.00 1.3087 0.0000 6030.23 6030.23 0.00% 51.20 51.20
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.82% 72.74 62 84 56.24 43 60 56.23 55 58 4090 4090 0.00%
crit 19.18% 17.26 6 28 112.36 86 120 112.39 102 120 1940 1940 0.00%

Action Details: Frostbolt

  • id:59638
  • school:frost
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.027000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:59638
  • name:Frostbolt
  • school:frost
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for {$d=4 seconds}.

Action Priority List

    default
    [ ]:31.00
Shifting Power 385 3.4% 5.9 49.48sec 19547 5473 Periodic 70.9 1372 2745 1637 19.3% 2.2%

Stats Details: Shifting Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.94 0.00 23.64 70.91 3.5718 0.8342 116094.44 116094.44 0.00% 5472.80 5472.80
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.70% 57.23 39 79 1372.31 1372 1372 1372.31 1372 1372 78539 78539 0.00%
crit 19.30% 13.68 4 25 2744.61 2745 2745 2744.61 2745 2745 37555 37555 0.00%

Action Details: Shifting Power

  • id:314791
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:4.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:314791
  • name:Shifting Power
  • school:nature
  • tooltip:Every $t1 sec, deal {$325130s1=0} Nature damage to enemies within $325130A1 yds and reduce the remaining cooldown of your abilities by ${-{$s2=3000}/1000} sec.
  • description:Draw power from the ground beneath, dealing ${{$325130s1=0}*{$d=4 seconds}/$t} Nature damage over {$d=4 seconds} to enemies within $325130A1 yds. While channeling, your Mage ability cooldowns are reduced by ${-{$s2=3000}/1000*{$d=4 seconds}/$t} sec over {$d=4 seconds}.

Action Details: Shifting Power Pulse

  • id:325130
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:18.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.473600
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:325130
  • name:Shifting Power
  • school:nature
  • tooltip:
  • description:{$@spelldesc314791=Draw power from the ground beneath, dealing ${{$325130s1=0}*{$d=4 seconds}/$t} Nature damage over {$d=4 seconds} to enemies within $325130A1 yds. While channeling, your Mage ability cooldowns are reduced by ${-{$s2=3000}/1000*{$d=4 seconds}/$t} sec over {$d=4 seconds}.}

Action Priority List

    aoe
    [n]:5.94
  • if_expr:buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
Touch of the Magi 0 (632) 0.0% (5.5%) 6.6 49.08sec 28825 22064

Stats Details: Touch Of The Magi

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.60 0.00 0.00 0.00 1.3065 0.0000 0.00 0.00 0.00% 22063.58 22063.58

Action Details: Touch Of The Magi

  • id:321507
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:4.0

Spelldata

  • id:321507
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]

Action Priority List

    aoe
    [j]:6.64
  • if_expr:buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
    Touch of the Magi (_explosion) 632 5.5% 6.6 48.93sec 28825 0 Direct 19.7 9687 0 9687 0.0%

Stats Details: Touch Of The Magi Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.60 19.69 0.00 0.00 0.0000 0.0000 190364.54 190364.54 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 19.69 15 24 9687.28 2483 35407 9682.91 8231 12129 190365 190365 0.00%

Action Details: Touch Of The Magi Explosion

  • id:210833
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:22837.07
  • base_dd_max:22837.07
  • base_dd_mult:1.00

Spelldata

  • id:210833
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:{$@spelldesc321507=Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]}
Simple Action Stats Execute Interval
Night_Fae
Arcane Power 3.6 97.18sec

Stats Details: Arcane Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.58 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Arcane Power

  • id:12042
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:12042
  • name:Arcane Power
  • school:arcane
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].

Action Priority List

    aoe
    [k]:3.59
  • if_expr:((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
Berserking 2.0 194.71sec

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    shared_cds
    [t]:2.00
  • if_expr:buff.arcane_power.up
Conjure Mana Gem 1.0 0.00sec

Stats Details: Conjure Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Conjure Mana Gem

  • id:759
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:9000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:759
  • name:Conjure Mana Gem
  • school:arcane
  • tooltip:
  • description:Conjures a Mana Gem that can be used to instantly restore {$5405s1=10}% mana, and holds up to {$s2=3} charges. $@spellname118812 {$@spelldesc118812=Conjured items disappear if logged out for more than 15 minutes.}
Evocation 0.3 0.00sec

Stats Details: Evocation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.25 0.00 1.50 0.00 4.2776 0.7215 0.00 0.00 0.00% 0.00 0.00

Action Details: Evocation

  • id:12051
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Night_Fae
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:12051
  • name:Evocation
  • school:arcane
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.

Action Priority List

    aoe
    [q]:0.25
  • interrupt_if_expr:mana.pct>=85
Spectral Flask of Power (flask) 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:307185
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Night_Fae
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of Gluttonous Hedonism (food) 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:308462
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Night_Fae
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Potion of Deathly Fixation (potion) 1.5 300.43sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.50 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:307497
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    shared_cds
    [s]:1.49
  • if_expr:buff.arcane_power.up
Rune of Power 6.4 47.92sec

Stats Details: Rune Of Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.41 0.00 0.00 0.00 1.2597 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Rune Of Power

  • id:116011
  • school:arcane
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:116011
  • name:Rune of Power
  • school:arcane
  • tooltip:
  • description:Places a Rune of Power on the ground for {$116011d=15 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.

Action Priority List

    aoe
    [l]:6.44
  • if_expr:buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
Replenish Mana (use_mana_gem) 2.8 120.62sec

Stats Details: Use Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.81 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Use Mana Gem

  • id:5405
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Night_Fae
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5405
  • name:Replenish Mana
  • school:physical
  • tooltip:Restoring $w2 mana every $t1 sec.
  • description:Restores {$s1=10}% mana.

Action Priority List

    shared_cds
    [r]:2.82
  • if_expr:(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Arcane Charge 55.2 150.2 5.5sec 1.5sec 4.2sec 76.30% 0.00% 3.5 (5.4) 0.0

Buff Details

  • buff initial source:Night_Fae
  • cooldown name:buff_arcane_charge
  • max_stacks:4
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 16.0s
  • trigger_min/max:0.0s / 9.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 13.5s

Stack Uptimes

  • arcane_charge_1:21.26%
  • arcane_charge_2:18.91%
  • arcane_charge_3:14.53%
  • arcane_charge_4:21.60%

Spelldata

  • id:36032
  • name:Arcane Charge
  • tooltip:Increases the damage of Arcane Blast, Arcane Missiles, Arcane Explosion, and Arcane Barrage by $36032w1%. Increases the mana cost of Arcane Blast by $36032w2%$?{$w5<0}[, and reduces the cast time of Arcane Blast by $w5%.][.] Increases the number of targets hit by Arcane Barrage for 50% damage by $36032w3.
  • description:$@spelldesc114664
  • max_stacks:4
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Arcane Power 3.6 0.0 97.2sec 97.2sec 14.7sec 17.48% 0.00% 0.0 (0.0) 3.5

Buff Details

  • buff initial source:Night_Fae
  • cooldown name:buff_arcane_power
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:96.0s / 102.1s
  • trigger_min/max:96.0s / 102.1s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 15.0s

Stack Uptimes

  • arcane_power_1:17.48%

Spelldata

  • id:12042
  • name:Arcane Power
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
Berserking 2.0 0.0 194.7sec 194.7sec 12.0sec 8.07% 23.61% 0.0 (0.0) 2.0

Buff Details

  • buff initial source:Night_Fae
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:192.7s / 199.3s
  • trigger_min/max:192.7s / 199.3s
  • trigger_pct:100.00%
  • duration_min/max:12.0s / 12.0s

Stack Uptimes

  • berserking_1:8.07%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.45% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Night_Fae
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.45%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Clearcasting 22.6 0.2 12.9sec 12.8sec 2.2sec 16.29% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Night_Fae
  • cooldown name:buff_clearcasting
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stack Uptimes

  • clearcasting_1:16.06%
  • clearcasting_2:0.24%

Spelldata

  • id:263725
  • name:Clearcasting
  • tooltip:Your next Arcane Missiles or Arcane Explosion costs no mana{$?s321758=false}[ and Arcane Missiles fires an additional missile][].
  • description:{$@spelldesc79684=For each ${$c*100/{$s1=200}} mana you spend, you have a 1% chance to gain Clearcasting, making your next Arcane Missiles or Arcane Explosion free and channel {$277726s1=20}% faster.$?a321758[ Arcane Missiles fires {$321758s2=1} additional missile.][]}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Evocation 0.3 0.0 0.0sec 0.0sec 4.3sec 0.36% 0.00% 1.0 (1.0) 0.0

Buff Details

  • buff initial source:Night_Fae
  • cooldown name:buff_evocation
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:7.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:1.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:1.1s / 4.3s

Stack Uptimes

  • evocation_1:0.36%

Spelldata

  • id:12051
  • name:Evocation
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Deathly Fixation 1.5 0.0 300.5sec 300.5sec 23.3sec 11.36% 0.00% 0.0 (0.0) 1.3

Buff Details

  • buff initial source:Night_Fae
  • cooldown name:buff_potion_of_deathly_fixation
  • max_stacks:1
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:300.0s / 301.1s
  • trigger_min/max:300.0s / 301.1s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 25.0s

Stack Uptimes

  • potion_of_deathly_fixation_1:11.36%

Spelldata

  • id:307497
  • name:Potion of Deathly Fixation
  • tooltip:Chance to apply Deathly Fixation to your target.
  • description:Your damaging spells and abilities have a chance to apply Deathly Fixation to your target, dealing {$322253s1=43} Shadow damage over {$322253d=8 seconds} and stacking up to 5 times. Upon reaching 5 stacks, Deathly Fixation explodes, dealing {$322256s1=985} Shadow damage to the target. If you consume this potion while your weapon is augmented with Shadowcore Oil, the explosion damage is increased by {$s2=10}%. Lasts {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Rune of Power 10.0 0.0 31.5sec 31.5sec 14.6sec 48.47% 0.00% 0.0 (0.0) 9.5

Buff Details

  • buff initial source:Night_Fae
  • cooldown name:buff_rune_of_power
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.40
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:16.8s / 48.7s
  • trigger_min/max:16.8s / 48.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • rune_of_power_1:48.47%

Spelldata

  • id:116014
  • name:Rune of Power
  • tooltip:Spell damage increased by $w1%.$?$w2=0[][ Health restored by $w2% per second.]
  • description:{$@spelldesc116011=Places a Rune of Power on the ground for {$116011d=15 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Well Fed (feast_of_gluttonous_hedonism)

Buff Details

  • buff initial source:Night_Fae
  • cooldown name:buff_feast_of_gluttonous_hedonism
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327708
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=20}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Spectral Flask of Power

Buff Details

  • buff initial source:Night_Fae
  • cooldown name:buff_spectral_flask_of_power
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:307185
  • name:Spectral Flask of Power
  • tooltip:$pri increased by $w1.
  • description:Increases $pri by {$s1=70} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs, Uptimes & Benefits

Benefit Avg % Min Max
Arcane Barrage Arcane Charge 4 100.00% 100.00% 100.00%
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 1.58% 0.76% 5.53% 0.9s 0.0s 4.7s
Conserve Phase 100.00% 100.00% 100.00% 301.4s 240.2s 359.7s

Cooldown waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Mirror Image0.0000.0000.000205.465144.158263.654
Evocation229.569127.355353.962287.802175.018359.637
Rune of Power14.2180.01636.63294.27976.256111.714
Touch of the Magi10.8770.00017.82274.19157.31492.867
Arcane Power1.2270.0036.1494.3972.0568.759
Arcane Barrage3.0390.00012.240166.934132.664200.658
Arcane Orb4.6020.00013.25764.66547.88280.663
Shifting Power9.3580.00033.25455.69550.14863.335

Burn Phases

Burn phase duration tracks the amount of time spent in each burn phase. This is defined as the time between a start_burn_phase and stop_burn_phase action being executed. Note that "execute" burn phases, i.e., the final burn of a fight, is also included.

Burn Phase Duration
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Mana at burn start is the mana level recorded (in percentage of total mana) when a start_burn_phase command is executed.

Mana at Burn Start
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
Night_Fae
mana_regen Mana 687.47 374417.73 69.57% 544.63 7091.27 1.86%
Evocation Mana 12.07 12141.63 2.26% 1006.09 0.00 0.00%
Mana Gem Mana 2.82 17860.60 3.32% 6337.14 0.00 0.00%
Arcane Barrage Mana 54.48 133751.74 24.85% 2455.10 4344.98 3.15%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 62371.4 1785.03 1885.53 11422.9 33073.6 1694.4 63371.4
Usage Type Count Total Avg RPE APR
Night_Fae
arcane_explosion Mana 143.2 529725.2 3699.0 3698.2 2.9
arcane_orb Mana 13.9 6205.2 445.5 445.5 42.8
shifting_power Mana 5.9 14850.7 2500.0 2500.5 7.8
touch_of_the_magi Mana 6.6 16529.3 2500.0 2502.9 11.5

Statistics & Data Analysis

Fight Length
Night_Fae Fight Length
Count 821
Mean 301.46
Minimum 240.16
Maximum 359.65
Spread ( max - min ) 119.50
Range [ ( max - min ) / 2 * 100% ] 19.82%
DPS
Night_Fae Damage Per Second
Count 821
Mean 11391.98
Minimum 10647.33
Maximum 12065.21
Spread ( max - min ) 1417.88
Range [ ( max - min ) / 2 * 100% ] 6.22%
Standard Deviation 251.8203
5th Percentile 11009.37
95th Percentile 11840.31
( 95th Percentile - 5th Percentile ) 830.94
Mean Distribution
Standard Deviation 8.7886
95.00% Confidence Interval ( 11374.75 - 11409.21 )
Normalized 95.00% Confidence Interval ( 99.85% - 100.15% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 19
0.1% Error 1878
0.1 Scale Factor Error with Delta=300 542
0.05 Scale Factor Error with Delta=300 2166
0.01 Scale Factor Error with Delta=300 54134
Priority Target DPS
Night_Fae Priority Target Damage Per Second
Count 821
Mean 4760.51
Minimum 4356.04
Maximum 5278.04
Spread ( max - min ) 922.00
Range [ ( max - min ) / 2 * 100% ] 9.68%
Standard Deviation 160.7664
5th Percentile 4514.22
95th Percentile 5051.52
( 95th Percentile - 5th Percentile ) 537.29
Mean Distribution
Standard Deviation 5.6108
95.00% Confidence Interval ( 4749.51 - 4771.51 )
Normalized 95.00% Confidence Interval ( 99.77% - 100.23% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 44
0.1% Error 4382
0.1 Scale Factor Error with Delta=300 221
0.05 Scale Factor Error with Delta=300 883
0.01 Scale Factor Error with Delta=300 22064
DPS(e)
Night_Fae Damage Per Second (Effective)
Count 821
Mean 11391.98
Minimum 10647.33
Maximum 12065.21
Spread ( max - min ) 1417.88
Range [ ( max - min ) / 2 * 100% ] 6.22%
Damage
Night_Fae Damage
Count 821
Mean 3424396.67
Minimum 2708322.87
Maximum 4140185.64
Spread ( max - min ) 1431862.76
Range [ ( max - min ) / 2 * 100% ] 20.91%
DTPS
Night_Fae Damage Taken Per Second
Count 821
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Night_Fae Healing Per Second
Count 821
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Night_Fae Healing Per Second (Effective)
Count 821
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Night_Fae Heal
Count 821
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Night_Fae Healing Taken Per Second
Count 821
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Night_Fae Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Night_FaeTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Night_Fae Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 variable,name=prepull_evo,op=reset,default=0
1 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
2 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
3 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
4 0.00 variable,name=have_opened,op=reset,default=0
5 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
6 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
7 0.00 variable,name=final_burn,op=set,value=0
8 0.00 variable,name=rs_max_delay,op=reset,default=5
9 0.00 variable,name=ap_max_delay,op=reset,default=10
A 0.00 variable,name=rop_max_delay,op=reset,default=20
B 0.00 variable,name=totm_max_delay,op=reset,default=5
C 0.00 variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
D 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
E 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
F 0.00 variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
G 0.00 variable,name=barrage_mana_pct,op=reset,default=70
H 0.00 variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
I 0.00 variable,name=ap_minimum_mana_pct,op=reset,default=30
J 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
K 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
L 0.00 variable,name=totm_max_charges,op=reset,default=2
M 0.00 variable,name=aoe_totm_max_charges,op=reset,default=2
N 0.00 variable,name=am_spam,op=reset,default=0
O 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
P 0.00 variable,name=am_spam_evo_pct,op=reset,default=15
Q 0.00 flask
R 0.00 food
S 0.00 augmentation
T 0.00 arcane_familiar
U 0.00 arcane_intellect
V 0.00 conjure_mana_gem
W 0.00 snapshot_stats
X 0.00 mirror_image
Y 0.00 frostbolt,if=variable.prepull_evo<=0
Z 0.00 evocation,if=variable.prepull_evo>0
Default action list Executed every time the actor is available.
# count action,conditions
0.00 counterspell,if=target.debuff.casting.react
a 0.00 call_action_list,name=shared_cds
b 0.00 call_action_list,name=essences
c 0.00 call_action_list,name=aoe,if=active_enemies>2
d 0.00 call_action_list,name=opener,if=variable.have_opened<=0
e 0.00 call_action_list,name=am_spam,if=variable.am_spam=1
f 0.00 call_action_list,name=cooldowns
g 0.00 call_action_list,name=rotation,if=variable.final_burn=0
h 0.00 call_action_list,name=final_burn,if=variable.final_burn=1
i 0.00 call_action_list,name=movement
actions.aoe
# count action,conditions
0.00 frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
0.00 arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
0.00 mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
j 6.64 touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
k 3.59 arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
l 6.44 rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
0.00 presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
0.00 arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
0.00 supernova
m 13.93 arcane_orb,if=buff.arcane_charge.stack=0
0.00 nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
n 5.94 shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
o 143.21 arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
0.00 arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
p 54.48 arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
q 0.25 evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.shared_cds
# count action,conditions
r 2.82 use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
0.00 use_items,if=buff.arcane_power.up
s 1.49 potion,if=buff.arcane_power.up
0.00 time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
0.00 lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
0.00 bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
t 2.00 berserking,if=buff.arcane_power.up
0.00 blood_fury,if=buff.arcane_power.up
0.00 fireblood,if=buff.arcane_power.up
0.00 ancestral_call,if=buff.arcane_power.up

Sample Sequence

045789ABDGHILMNPQRVXYjkstpmpoooopoooopoooolpoooorpmpoooopoonoopmpoooopoojlpoooopmpoooopoooopoonoopmpoooopojkpoooopoooopmlpoooopooooponooopmporooopjlpoooopoooopmpooooponooopmpoooopjktpoooopoooopmpoooolpoooopoooopmnpoooopmpoojlpoooopooroopmpoooopoonoopmpojkpooooposooopoooolpmpoooopoooonp

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 prepull_evo Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 4 have_opened Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 5 have_opened Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 7 final_burn Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 8 rs_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 9 ap_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat A rop_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat B totm_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat D totm_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat G barrage_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat H barrage_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat I ap_minimum_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat L totm_max_charges Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat M aoe_totm_max_charges Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat N am_spam Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat P am_spam_evo_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat Q flask Night_Fae 63371.4/63371: 100% mana
Pre precombat R food Night_Fae 63371.4/63371: 100% mana
Pre precombat V conjure_mana_gem Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat X mirror_image Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat Y frostbolt Fluffy_Pillow 63371.4/63371: 100% mana
0:00.000 aoe j touch_of_the_magi Fluffy_Pillow 62371.4/63371: 98% mana
0:01.306 aoe k arcane_power Fluffy_Pillow 60876.5/63371: 96% mana bloodlust, arcane_charge(4)
0:01.306 shared_cds s potion Fluffy_Pillow 60876.5/63371: 96% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power
0:01.306 shared_cds t berserking Fluffy_Pillow 60876.5/63371: 96% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:01.306 aoe p arcane_barrage Fluffy_Pillow 60876.5/63371: 96% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:02.221 aoe m arcane_orb Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_power, rune_of_power, potion_of_deathly_fixation
0:03.135 aoe p arcane_barrage Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:04.048 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_power, rune_of_power, potion_of_deathly_fixation
0:04.963 aoe o arcane_explosion Fluffy_Pillow 62031.1/63371: 98% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, potion_of_deathly_fixation
0:05.879 aoe o arcane_explosion Fluffy_Pillow 60692.1/63371: 96% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, potion_of_deathly_fixation
0:06.791 aoe o arcane_explosion Fluffy_Pillow 59348.0/63371: 94% mana bloodlust, berserking, arcane_charge(3), arcane_power, rune_of_power, potion_of_deathly_fixation
0:07.707 aoe p arcane_barrage Fluffy_Pillow 58008.9/63371: 92% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:08.624 aoe o arcane_explosion Fluffy_Pillow 61706.0/63371: 97% mana bloodlust, berserking, arcane_power, rune_of_power, potion_of_deathly_fixation
0:09.537 aoe o arcane_explosion Fluffy_Pillow 60363.2/63371: 95% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, potion_of_deathly_fixation
0:10.454 aoe o arcane_explosion Fluffy_Pillow 59025.4/63371: 93% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, potion_of_deathly_fixation
0:11.368 aoe o arcane_explosion Fluffy_Pillow 57683.9/63371: 91% mana bloodlust, berserking, arcane_charge(3), arcane_power, rune_of_power, potion_of_deathly_fixation
0:12.282 aoe p arcane_barrage Fluffy_Pillow 56342.3/63371: 89% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:13.198 aoe o arcane_explosion Fluffy_Pillow 60038.1/63371: 95% mana bloodlust, berserking, arcane_power, rune_of_power, potion_of_deathly_fixation
0:14.114 aoe o arcane_explosion Fluffy_Pillow 58699.1/63371: 93% mana bloodlust, arcane_charge, arcane_power, rune_of_power, potion_of_deathly_fixation
0:15.121 aoe o arcane_explosion Fluffy_Pillow 57475.4/63371: 91% mana bloodlust, arcane_charge(2), arcane_power, rune_of_power, potion_of_deathly_fixation
0:16.126 aoe o arcane_explosion Fluffy_Pillow 56249.1/63371: 89% mana bloodlust, arcane_charge(3), arcane_power, rune_of_power, potion_of_deathly_fixation
0:17.132 aoe l rune_of_power Fluffy_Pillow 55024.2/63371: 87% mana bloodlust, arcane_charge(4), clearcasting, potion_of_deathly_fixation
0:18.139 aoe p arcane_barrage Fluffy_Pillow 56300.5/63371: 89% mana bloodlust, arcane_charge(4), clearcasting, rune_of_power, potion_of_deathly_fixation
0:19.144 aoe o arcane_explosion Fluffy_Pillow 60109.1/63371: 95% mana bloodlust, clearcasting, rune_of_power, potion_of_deathly_fixation
0:20.150 aoe o arcane_explosion Fluffy_Pillow 61384.1/63371: 97% mana bloodlust, arcane_charge, rune_of_power, potion_of_deathly_fixation
0:21.157 aoe o arcane_explosion Fluffy_Pillow 57660.4/63371: 91% mana bloodlust, arcane_charge(2), rune_of_power, potion_of_deathly_fixation
0:22.162 aoe o arcane_explosion Fluffy_Pillow 53934.2/63371: 85% mana bloodlust, arcane_charge(3), rune_of_power, potion_of_deathly_fixation
0:23.169 shared_cds r use_mana_gem Night_Fae 50210.5/63371: 79% mana bloodlust, arcane_charge(4), rune_of_power, potion_of_deathly_fixation
0:23.169 aoe p arcane_barrage Fluffy_Pillow 56547.6/63371: 89% mana bloodlust, arcane_charge(4), rune_of_power, potion_of_deathly_fixation
0:24.174 aoe m arcane_orb Fluffy_Pillow 60356.3/63371: 95% mana bloodlust, rune_of_power, potion_of_deathly_fixation
0:25.182 aoe p arcane_barrage Fluffy_Pillow 61133.8/63371: 96% mana bloodlust, arcane_charge(4), rune_of_power, potion_of_deathly_fixation
0:26.186 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, rune_of_power, potion_of_deathly_fixation
0:27.192 aoe o arcane_explosion Fluffy_Pillow 59646.5/63371: 94% mana bloodlust, arcane_charge, rune_of_power
0:28.200 aoe o arcane_explosion Fluffy_Pillow 55924.0/63371: 88% mana bloodlust, arcane_charge(2), clearcasting, rune_of_power
0:29.207 aoe o arcane_explosion Fluffy_Pillow 57200.3/63371: 90% mana bloodlust, arcane_charge(3), rune_of_power
0:30.212 aoe p arcane_barrage Fluffy_Pillow 53474.1/63371: 84% mana bloodlust, arcane_charge(4), rune_of_power
0:31.218 aoe o arcane_explosion Fluffy_Pillow 57284.0/63371: 90% mana bloodlust, rune_of_power
0:32.225 aoe o arcane_explosion Fluffy_Pillow 53560.3/63371: 85% mana bloodlust, arcane_charge, rune_of_power
0:33.232 aoe n shifting_power Fluffy_Pillow 49836.6/63371: 79% mana bloodlust, arcane_charge(2)
0:36.039 aoe o arcane_explosion Fluffy_Pillow 50894.3/63371: 80% mana bloodlust, arcane_charge(2)
0:37.043 aoe o arcane_explosion Fluffy_Pillow 47166.8/63371: 74% mana bloodlust, arcane_charge(3)
0:38.049 aoe p arcane_barrage Fluffy_Pillow 43441.8/63371: 69% mana bloodlust, arcane_charge(4)
0:39.056 aoe m arcane_orb Fluffy_Pillow 47252.9/63371: 75% mana bloodlust
0:40.061 aoe p arcane_barrage Fluffy_Pillow 48026.7/63371: 76% mana bloodlust, arcane_charge(4)
0:41.067 aoe o arcane_explosion Fluffy_Pillow 51836.6/63371: 82% mana
0:42.372 aoe o arcane_explosion Fluffy_Pillow 48490.6/63371: 77% mana arcane_charge
0:43.679 aoe o arcane_explosion Fluffy_Pillow 45147.1/63371: 71% mana arcane_charge(2), clearcasting
0:44.985 aoe o arcane_explosion Fluffy_Pillow 46802.4/63371: 74% mana arcane_charge(3)
0:46.291 aoe p arcane_barrage Fluffy_Pillow 43457.7/63371: 69% mana arcane_charge(4)
0:47.598 aoe o arcane_explosion Fluffy_Pillow 47649.0/63371: 75% mana
0:48.904 aoe o arcane_explosion Fluffy_Pillow 44304.3/63371: 70% mana arcane_charge
0:50.210 aoe j touch_of_the_magi Fluffy_Pillow 40959.6/63371: 65% mana arcane_charge(2)
0:51.517 aoe l rune_of_power Fluffy_Pillow 40116.1/63371: 63% mana arcane_charge(4)
0:52.825 aoe p arcane_barrage Fluffy_Pillow 41773.9/63371: 66% mana arcane_charge(4), rune_of_power
0:54.131 aoe o arcane_explosion Fluffy_Pillow 45964.0/63371: 73% mana rune_of_power
0:55.437 aoe o arcane_explosion Fluffy_Pillow 42619.3/63371: 67% mana arcane_charge, rune_of_power
0:56.743 aoe o arcane_explosion Fluffy_Pillow 39274.5/63371: 62% mana arcane_charge(2), rune_of_power
0:58.050 aoe o arcane_explosion Fluffy_Pillow 35931.1/63371: 57% mana arcane_charge(3), rune_of_power
0:59.357 aoe p arcane_barrage Fluffy_Pillow 32587.6/63371: 51% mana arcane_charge(4), rune_of_power
1:00.664 aoe m arcane_orb Fluffy_Pillow 36779.0/63371: 58% mana rune_of_power
1:01.971 aoe p arcane_barrage Fluffy_Pillow 37935.5/63371: 60% mana arcane_charge(4), rune_of_power
1:03.278 aoe o arcane_explosion Fluffy_Pillow 42126.9/63371: 66% mana rune_of_power
1:04.584 aoe o arcane_explosion Fluffy_Pillow 38782.2/63371: 61% mana arcane_charge, rune_of_power
1:05.890 aoe o arcane_explosion Fluffy_Pillow 35437.4/63371: 56% mana arcane_charge(2), rune_of_power
1:07.197 aoe o arcane_explosion Fluffy_Pillow 32093.9/63371: 51% mana arcane_charge(3), rune_of_power
1:08.504 aoe p arcane_barrage Fluffy_Pillow 28750.5/63371: 45% mana arcane_charge(4), clearcasting
1:09.812 aoe o arcane_explosion Fluffy_Pillow 32943.1/63371: 52% mana clearcasting
1:11.121 aoe o arcane_explosion Fluffy_Pillow 34602.2/63371: 55% mana arcane_charge
1:12.426 aoe o arcane_explosion Fluffy_Pillow 31256.2/63371: 49% mana arcane_charge(2)
1:13.733 aoe o arcane_explosion Fluffy_Pillow 27912.7/63371: 44% mana arcane_charge(3)
1:15.043 aoe p arcane_barrage Fluffy_Pillow 24573.0/63371: 39% mana arcane_charge(4)
1:16.348 aoe o arcane_explosion Fluffy_Pillow 28761.9/63371: 45% mana
1:17.655 aoe o arcane_explosion Fluffy_Pillow 25418.4/63371: 40% mana arcane_charge
1:18.961 aoe n shifting_power Fluffy_Pillow 22073.7/63371: 35% mana arcane_charge(2)
1:22.650 aoe o arcane_explosion Fluffy_Pillow 24249.2/63371: 38% mana arcane_charge(2)
1:23.958 aoe o arcane_explosion Fluffy_Pillow 20907.0/63371: 33% mana arcane_charge(3), clearcasting
1:25.264 aoe p arcane_barrage Fluffy_Pillow 22562.3/63371: 36% mana arcane_charge(4)
1:26.571 aoe m arcane_orb Fluffy_Pillow 26753.7/63371: 42% mana
1:27.879 aoe p arcane_barrage Fluffy_Pillow 27911.5/63371: 44% mana arcane_charge(4)
1:29.185 aoe o arcane_explosion Fluffy_Pillow 32101.6/63371: 51% mana
1:30.492 aoe o arcane_explosion Fluffy_Pillow 28758.1/63371: 45% mana arcane_charge
1:31.800 aoe o arcane_explosion Fluffy_Pillow 25415.9/63371: 40% mana arcane_charge(2)
1:33.106 aoe o arcane_explosion Fluffy_Pillow 22071.2/63371: 35% mana arcane_charge(3)
1:34.411 aoe p arcane_barrage Fluffy_Pillow 18725.2/63371: 30% mana arcane_charge(4)
1:35.717 aoe o arcane_explosion Fluffy_Pillow 22915.3/63371: 36% mana
1:37.024 aoe j touch_of_the_magi Fluffy_Pillow 19571.8/63371: 31% mana arcane_charge
1:38.330 aoe k arcane_power Fluffy_Pillow 18727.1/63371: 30% mana arcane_charge(4)
1:38.330 aoe p arcane_barrage Fluffy_Pillow 18727.1/63371: 30% mana arcane_charge(4), arcane_power, rune_of_power
1:39.637 aoe o arcane_explosion Fluffy_Pillow 22918.5/63371: 36% mana arcane_power, rune_of_power
1:40.942 aoe o arcane_explosion Fluffy_Pillow 22072.5/63371: 35% mana arcane_charge, arcane_power, rune_of_power
1:42.248 aoe o arcane_explosion Fluffy_Pillow 21227.7/63371: 33% mana arcane_charge(2), arcane_power, clearcasting, rune_of_power
1:43.555 aoe o arcane_explosion Fluffy_Pillow 22884.3/63371: 36% mana arcane_charge(3), arcane_power, rune_of_power
1:44.862 aoe p arcane_barrage Fluffy_Pillow 22040.8/63371: 35% mana arcane_charge(4), arcane_power, rune_of_power
1:46.168 aoe o arcane_explosion Fluffy_Pillow 26230.9/63371: 41% mana arcane_power, rune_of_power
1:47.474 aoe o arcane_explosion Fluffy_Pillow 25386.2/63371: 40% mana arcane_charge, arcane_power, rune_of_power
1:48.780 aoe o arcane_explosion Fluffy_Pillow 24541.4/63371: 39% mana arcane_charge(2), arcane_power, rune_of_power
1:50.087 aoe o arcane_explosion Fluffy_Pillow 23698.0/63371: 37% mana arcane_charge(3), arcane_power, rune_of_power
1:51.392 aoe p arcane_barrage Fluffy_Pillow 22851.9/63371: 36% mana arcane_charge(4), arcane_power, rune_of_power
1:52.697 aoe m arcane_orb Fluffy_Pillow 27040.8/63371: 43% mana arcane_power, rune_of_power
1:54.004 aoe l rune_of_power Fluffy_Pillow 28447.3/63371: 45% mana arcane_charge(4)
1:55.310 aoe p arcane_barrage Fluffy_Pillow 30102.6/63371: 48% mana arcane_charge(4), rune_of_power
1:56.617 aoe o arcane_explosion Fluffy_Pillow 34294.0/63371: 54% mana rune_of_power
1:57.924 aoe o arcane_explosion Fluffy_Pillow 30950.5/63371: 49% mana arcane_charge, rune_of_power
1:59.232 aoe o arcane_explosion Fluffy_Pillow 27608.3/63371: 44% mana arcane_charge(2), rune_of_power
2:00.539 aoe o arcane_explosion Fluffy_Pillow 24264.8/63371: 38% mana arcane_charge(3), rune_of_power
2:01.847 aoe p arcane_barrage Fluffy_Pillow 20922.6/63371: 33% mana arcane_charge(4), clearcasting, rune_of_power
2:03.154 aoe o arcane_explosion Fluffy_Pillow 25114.0/63371: 40% mana clearcasting, rune_of_power
2:04.460 aoe o arcane_explosion Fluffy_Pillow 26769.3/63371: 42% mana arcane_charge, rune_of_power
2:05.766 aoe o arcane_explosion Fluffy_Pillow 23424.5/63371: 37% mana arcane_charge(2), rune_of_power
2:07.073 aoe o arcane_explosion Fluffy_Pillow 20081.1/63371: 32% mana arcane_charge(3), rune_of_power
2:08.381 aoe p arcane_barrage Fluffy_Pillow 16738.9/63371: 26% mana arcane_charge(4), clearcasting, rune_of_power
2:09.688 aoe o arcane_explosion Fluffy_Pillow 20930.2/63371: 33% mana clearcasting, rune_of_power
2:10.996 aoe n shifting_power Fluffy_Pillow 22588.0/63371: 36% mana arcane_charge
2:14.820 aoe o arcane_explosion Fluffy_Pillow 24934.7/63371: 39% mana arcane_charge, clearcasting
2:16.127 aoe o arcane_explosion Fluffy_Pillow 26591.2/63371: 42% mana arcane_charge(2)
2:17.433 aoe o arcane_explosion Fluffy_Pillow 23246.5/63371: 37% mana arcane_charge(3)
2:18.739 aoe p arcane_barrage Fluffy_Pillow 19901.7/63371: 31% mana arcane_charge(4)
2:20.046 aoe m arcane_orb Fluffy_Pillow 24093.1/63371: 38% mana
2:21.353 aoe p arcane_barrage Fluffy_Pillow 25249.7/63371: 40% mana arcane_charge(4)
2:22.658 aoe o arcane_explosion Fluffy_Pillow 29438.5/63371: 46% mana
2:23.964 shared_cds r use_mana_gem Night_Fae 26093.8/63371: 41% mana arcane_charge, clearcasting
2:23.964 aoe o arcane_explosion Fluffy_Pillow 32430.9/63371: 51% mana arcane_charge, clearcasting
2:25.270 aoe o arcane_explosion Fluffy_Pillow 34086.2/63371: 54% mana arcane_charge(2)
2:26.577 aoe o arcane_explosion Fluffy_Pillow 30742.7/63371: 49% mana arcane_charge(3)
2:27.884 aoe p arcane_barrage Fluffy_Pillow 27399.2/63371: 43% mana arcane_charge(4)
2:29.190 aoe j touch_of_the_magi Fluffy_Pillow 31589.4/63371: 50% mana
2:30.496 aoe l rune_of_power Fluffy_Pillow 30744.6/63371: 49% mana arcane_charge(4)
2:31.803 aoe p arcane_barrage Fluffy_Pillow 32401.1/63371: 51% mana arcane_charge(4), rune_of_power
2:33.111 aoe o arcane_explosion Fluffy_Pillow 36593.8/63371: 58% mana rune_of_power
2:34.417 aoe o arcane_explosion Fluffy_Pillow 33249.1/63371: 52% mana arcane_charge, rune_of_power
2:35.723 aoe o arcane_explosion Fluffy_Pillow 29904.3/63371: 47% mana arcane_charge(2), rune_of_power
2:37.028 aoe o arcane_explosion Fluffy_Pillow 26558.3/63371: 42% mana arcane_charge(3), rune_of_power
2:38.334 aoe p arcane_barrage Fluffy_Pillow 23213.6/63371: 37% mana arcane_charge(4), clearcasting, rune_of_power
2:39.641 aoe o arcane_explosion Fluffy_Pillow 27405.0/63371: 43% mana clearcasting, rune_of_power
2:40.948 aoe o arcane_explosion Fluffy_Pillow 29061.5/63371: 46% mana arcane_charge, rune_of_power
2:42.258 aoe o arcane_explosion Fluffy_Pillow 25721.8/63371: 41% mana arcane_charge(2), rune_of_power
2:43.564 aoe o arcane_explosion Fluffy_Pillow 22377.1/63371: 35% mana arcane_charge(3), clearcasting, rune_of_power
2:44.870 aoe p arcane_barrage Fluffy_Pillow 24032.3/63371: 38% mana arcane_charge(4), rune_of_power
2:46.176 aoe m arcane_orb Fluffy_Pillow 28222.5/63371: 45% mana rune_of_power
2:47.485 aoe p arcane_barrage Fluffy_Pillow 29381.5/63371: 46% mana arcane_charge(4), clearcasting
2:48.792 aoe o arcane_explosion Fluffy_Pillow 33572.9/63371: 53% mana clearcasting
2:50.098 aoe o arcane_explosion Fluffy_Pillow 35228.2/63371: 56% mana arcane_charge
2:51.404 aoe o arcane_explosion Fluffy_Pillow 31883.4/63371: 50% mana arcane_charge(2)
2:52.711 aoe o arcane_explosion Fluffy_Pillow 28540.0/63371: 45% mana arcane_charge(3)
2:54.016 aoe p arcane_barrage Fluffy_Pillow 25194.0/63371: 40% mana arcane_charge(4)
2:55.323 aoe o arcane_explosion Fluffy_Pillow 29385.4/63371: 46% mana
2:56.629 aoe n shifting_power Fluffy_Pillow 26040.6/63371: 41% mana arcane_charge
3:00.325 aoe o arcane_explosion Fluffy_Pillow 28225.0/63371: 45% mana arcane_charge
3:01.632 aoe o arcane_explosion Fluffy_Pillow 24881.6/63371: 39% mana arcane_charge(2), clearcasting
3:02.938 aoe o arcane_explosion Fluffy_Pillow 26536.8/63371: 42% mana arcane_charge(3)
3:04.245 aoe p arcane_barrage Fluffy_Pillow 23193.3/63371: 37% mana arcane_charge(4)
3:05.551 aoe m arcane_orb Fluffy_Pillow 27383.5/63371: 43% mana
3:06.859 aoe p arcane_barrage Fluffy_Pillow 28541.3/63371: 45% mana arcane_charge(4)
3:08.164 aoe o arcane_explosion Fluffy_Pillow 32730.1/63371: 52% mana
3:09.469 aoe o arcane_explosion Fluffy_Pillow 29384.1/63371: 46% mana arcane_charge
3:10.774 aoe o arcane_explosion Fluffy_Pillow 26038.1/63371: 41% mana arcane_charge(2), clearcasting
3:12.079 aoe o arcane_explosion Fluffy_Pillow 27692.1/63371: 44% mana arcane_charge(3)
3:13.385 aoe p arcane_barrage Fluffy_Pillow 24347.4/63371: 38% mana arcane_charge(4)
3:14.691 aoe j touch_of_the_magi Fluffy_Pillow 28537.5/63371: 45% mana
3:15.997 aoe k arcane_power Fluffy_Pillow 27692.7/63371: 44% mana arcane_charge(4)
3:15.997 shared_cds t berserking Fluffy_Pillow 27692.7/63371: 44% mana arcane_charge(4), arcane_power, rune_of_power
3:15.997 aoe p arcane_barrage Fluffy_Pillow 27692.7/63371: 44% mana berserking, arcane_charge(4), arcane_power, rune_of_power
3:17.186 aoe o arcane_explosion Fluffy_Pillow 31734.6/63371: 50% mana berserking, arcane_power, rune_of_power
3:18.374 aoe o arcane_explosion Fluffy_Pillow 30740.3/63371: 49% mana berserking, arcane_charge, arcane_power, rune_of_power
3:19.560 aoe o arcane_explosion Fluffy_Pillow 29743.4/63371: 47% mana berserking, arcane_charge(2), arcane_power, rune_of_power
3:20.751 aoe o arcane_explosion Fluffy_Pillow 28753.0/63371: 45% mana berserking, arcane_charge(3), arcane_power, rune_of_power
3:21.939 aoe p arcane_barrage Fluffy_Pillow 27758.7/63371: 44% mana berserking, arcane_charge(4), arcane_power, rune_of_power
3:23.130 aoe o arcane_explosion Fluffy_Pillow 31803.0/63371: 50% mana berserking, arcane_power, rune_of_power
3:24.319 aoe o arcane_explosion Fluffy_Pillow 30810.0/63371: 49% mana berserking, arcane_charge, arcane_power, rune_of_power
3:25.506 aoe o arcane_explosion Fluffy_Pillow 29814.4/63371: 47% mana berserking, arcane_charge(2), arcane_power, rune_of_power
3:26.694 aoe o arcane_explosion Fluffy_Pillow 28820.1/63371: 45% mana berserking, arcane_charge(3), arcane_power, rune_of_power
3:27.881 aoe p arcane_barrage Fluffy_Pillow 27824.6/63371: 44% mana berserking, arcane_charge(4), arcane_power, clearcasting, rune_of_power
3:29.071 aoe m arcane_orb Fluffy_Pillow 31867.7/63371: 50% mana arcane_power, clearcasting, rune_of_power
3:30.378 aoe p arcane_barrage Fluffy_Pillow 33274.2/63371: 53% mana arcane_charge(4), arcane_power, clearcasting, rune_of_power
3:31.779 aoe o arcane_explosion Fluffy_Pillow 37584.7/63371: 59% mana clearcasting
3:33.084 aoe o arcane_explosion Fluffy_Pillow 39238.7/63371: 62% mana arcane_charge
3:34.388 aoe o arcane_explosion Fluffy_Pillow 35891.4/63371: 57% mana arcane_charge(2)
3:35.692 aoe o arcane_explosion Fluffy_Pillow 32544.2/63371: 51% mana arcane_charge(3)
3:37.000 aoe l rune_of_power Fluffy_Pillow 29202.0/63371: 46% mana arcane_charge(4)
3:38.306 aoe p arcane_barrage Fluffy_Pillow 30857.2/63371: 49% mana arcane_charge(4), rune_of_power
3:39.611 aoe o arcane_explosion Fluffy_Pillow 35046.1/63371: 55% mana rune_of_power
3:40.917 aoe o arcane_explosion Fluffy_Pillow 31701.3/63371: 50% mana arcane_charge, rune_of_power
3:42.224 aoe o arcane_explosion Fluffy_Pillow 28357.9/63371: 45% mana arcane_charge(2), rune_of_power
3:43.530 aoe o arcane_explosion Fluffy_Pillow 25013.1/63371: 39% mana arcane_charge(3), rune_of_power
3:44.837 aoe p arcane_barrage Fluffy_Pillow 21669.7/63371: 34% mana arcane_charge(4), rune_of_power
3:46.144 aoe o arcane_explosion Fluffy_Pillow 25861.1/63371: 41% mana rune_of_power
3:47.451 aoe o arcane_explosion Fluffy_Pillow 22517.6/63371: 36% mana arcane_charge, rune_of_power
3:48.757 aoe o arcane_explosion Fluffy_Pillow 19172.8/63371: 30% mana arcane_charge(2), rune_of_power
3:50.063 aoe o arcane_explosion Fluffy_Pillow 15828.1/63371: 25% mana arcane_charge(3), rune_of_power
3:51.369 aoe p arcane_barrage Fluffy_Pillow 12483.4/63371: 20% mana arcane_charge(4), rune_of_power
3:52.676 aoe m arcane_orb Fluffy_Pillow 16674.8/63371: 26% mana rune_of_power
3:53.981 aoe n shifting_power Fluffy_Pillow 17828.7/63371: 28% mana arcane_charge(4)
3:57.710 aoe p arcane_barrage Fluffy_Pillow 20055.0/63371: 32% mana arcane_charge(4)
3:59.017 aoe o arcane_explosion Fluffy_Pillow 24246.4/63371: 38% mana
4:00.322 aoe o arcane_explosion Fluffy_Pillow 20900.4/63371: 33% mana arcane_charge
4:01.628 aoe o arcane_explosion Fluffy_Pillow 17555.6/63371: 28% mana arcane_charge(2)
4:02.936 aoe o arcane_explosion Fluffy_Pillow 14213.4/63371: 22% mana arcane_charge(3)
4:04.244 aoe p arcane_barrage Fluffy_Pillow 10871.2/63371: 17% mana arcane_charge(4)
4:05.550 aoe m arcane_orb Fluffy_Pillow 15061.3/63371: 24% mana
4:06.859 aoe p arcane_barrage Fluffy_Pillow 16220.4/63371: 26% mana arcane_charge(4)
4:08.165 aoe o arcane_explosion Fluffy_Pillow 20410.5/63371: 32% mana
4:09.472 aoe o arcane_explosion Fluffy_Pillow 17067.1/63371: 27% mana arcane_charge
4:10.776 aoe j touch_of_the_magi Fluffy_Pillow 13719.8/63371: 22% mana arcane_charge(2)
4:12.082 aoe l rune_of_power Fluffy_Pillow 12875.0/63371: 20% mana arcane_charge(4)
4:13.388 aoe p arcane_barrage Fluffy_Pillow 14530.3/63371: 23% mana arcane_charge(4), rune_of_power
4:14.696 aoe o arcane_explosion Fluffy_Pillow 18723.0/63371: 30% mana rune_of_power
4:16.003 aoe o arcane_explosion Fluffy_Pillow 15379.5/63371: 24% mana arcane_charge, rune_of_power
4:17.311 aoe o arcane_explosion Fluffy_Pillow 12037.3/63371: 19% mana arcane_charge(2), rune_of_power
4:18.618 aoe o arcane_explosion Fluffy_Pillow 8693.8/63371: 14% mana arcane_charge(3), clearcasting, rune_of_power
4:19.924 aoe p arcane_barrage Fluffy_Pillow 10349.1/63371: 16% mana arcane_charge(4), rune_of_power
4:21.230 aoe o arcane_explosion Fluffy_Pillow 14539.2/63371: 23% mana rune_of_power
4:22.536 aoe o arcane_explosion Fluffy_Pillow 11194.5/63371: 18% mana arcane_charge, rune_of_power
4:23.843 shared_cds r use_mana_gem Night_Fae 7851.0/63371: 12% mana arcane_charge(2), rune_of_power
4:23.964 aoe o arcane_explosion Fluffy_Pillow 14341.5/63371: 23% mana arcane_charge(2), rune_of_power
4:25.270 aoe o arcane_explosion Fluffy_Pillow 10996.7/63371: 17% mana arcane_charge(3), clearcasting, rune_of_power
4:26.578 aoe p arcane_barrage Fluffy_Pillow 12654.5/63371: 20% mana arcane_charge(4), rune_of_power
4:27.883 aoe m arcane_orb Fluffy_Pillow 16843.4/63371: 27% mana rune_of_power
4:29.190 aoe p arcane_barrage Fluffy_Pillow 17999.9/63371: 28% mana arcane_charge(4)
4:30.497 aoe o arcane_explosion Fluffy_Pillow 22191.3/63371: 35% mana
4:31.804 aoe o arcane_explosion Fluffy_Pillow 18847.8/63371: 30% mana arcane_charge
4:33.111 aoe o arcane_explosion Fluffy_Pillow 15504.4/63371: 24% mana arcane_charge(2)
4:34.419 aoe o arcane_explosion Fluffy_Pillow 12162.2/63371: 19% mana arcane_charge(3)
4:35.726 aoe p arcane_barrage Fluffy_Pillow 8818.7/63371: 14% mana arcane_charge(4)
4:37.034 aoe o arcane_explosion Fluffy_Pillow 13011.4/63371: 21% mana
4:38.341 aoe o arcane_explosion Fluffy_Pillow 9667.9/63371: 15% mana arcane_charge
4:39.648 aoe n shifting_power Fluffy_Pillow 6324.4/63371: 10% mana arcane_charge(2)
4:43.477 aoe o arcane_explosion Fluffy_Pillow 8677.4/63371: 14% mana arcane_charge(2), clearcasting
4:44.782 aoe o arcane_explosion Fluffy_Pillow 10331.4/63371: 16% mana arcane_charge(3)
4:46.088 aoe p arcane_barrage Fluffy_Pillow 6986.6/63371: 11% mana arcane_charge(4)
4:47.393 aoe m arcane_orb Fluffy_Pillow 11175.5/63371: 18% mana
4:48.699 aoe p arcane_barrage Fluffy_Pillow 12330.8/63371: 19% mana arcane_charge(4)
4:50.005 aoe o arcane_explosion Fluffy_Pillow 16520.9/63371: 26% mana
4:51.311 aoe j touch_of_the_magi Fluffy_Pillow 13176.1/63371: 21% mana arcane_charge
4:52.618 aoe k arcane_power Fluffy_Pillow 12332.7/63371: 19% mana arcane_charge(4)
4:52.618 aoe p arcane_barrage Fluffy_Pillow 12332.7/63371: 19% mana arcane_charge(4), arcane_power, rune_of_power
4:53.925 aoe o arcane_explosion Fluffy_Pillow 16524.1/63371: 26% mana arcane_power, rune_of_power
4:55.230 aoe o arcane_explosion Fluffy_Pillow 15678.1/63371: 25% mana arcane_charge, arcane_power, rune_of_power
4:56.536 aoe o arcane_explosion Fluffy_Pillow 14833.3/63371: 23% mana arcane_charge(2), arcane_power, rune_of_power
4:57.841 aoe o arcane_explosion Fluffy_Pillow 13987.3/63371: 22% mana arcane_charge(3), arcane_power, rune_of_power
4:59.146 aoe p arcane_barrage Fluffy_Pillow 13141.3/63371: 21% mana arcane_charge(4), arcane_power, rune_of_power
5:00.451 aoe o arcane_explosion Fluffy_Pillow 17330.2/63371: 27% mana arcane_power, rune_of_power
5:01.758 shared_cds s potion Fluffy_Pillow 16486.7/63371: 26% mana arcane_charge, arcane_power, rune_of_power
5:01.758 aoe o arcane_explosion Fluffy_Pillow 16486.7/63371: 26% mana arcane_charge, arcane_power, rune_of_power, potion_of_deathly_fixation
5:03.064 aoe o arcane_explosion Fluffy_Pillow 15641.9/63371: 25% mana arcane_charge(2), arcane_power, rune_of_power, potion_of_deathly_fixation
5:04.371 aoe o arcane_explosion Fluffy_Pillow 14798.5/63371: 23% mana arcane_charge(3), arcane_power, rune_of_power, potion_of_deathly_fixation
5:05.677 aoe p arcane_barrage Fluffy_Pillow 13953.7/63371: 22% mana arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
5:06.982 aoe o arcane_explosion Fluffy_Pillow 18142.6/63371: 29% mana arcane_power, rune_of_power, potion_of_deathly_fixation
5:08.288 aoe o arcane_explosion Fluffy_Pillow 17297.8/63371: 27% mana arcane_charge, potion_of_deathly_fixation
5:09.594 aoe o arcane_explosion Fluffy_Pillow 13953.1/63371: 22% mana arcane_charge(2), clearcasting, potion_of_deathly_fixation
5:10.902 aoe o arcane_explosion Fluffy_Pillow 15610.9/63371: 25% mana arcane_charge(3), potion_of_deathly_fixation
5:12.206 aoe l rune_of_power Fluffy_Pillow 12263.6/63371: 19% mana arcane_charge(4), potion_of_deathly_fixation
5:13.512 aoe p arcane_barrage Fluffy_Pillow 13918.9/63371: 22% mana arcane_charge(4), rune_of_power, potion_of_deathly_fixation
5:14.820 aoe m arcane_orb Fluffy_Pillow 18111.5/63371: 29% mana rune_of_power, potion_of_deathly_fixation
5:16.126 aoe p arcane_barrage Fluffy_Pillow 19266.8/63371: 30% mana arcane_charge(4), rune_of_power, potion_of_deathly_fixation
5:17.435 aoe o arcane_explosion Fluffy_Pillow 23460.7/63371: 37% mana rune_of_power, potion_of_deathly_fixation
5:18.740 aoe o arcane_explosion Fluffy_Pillow 20114.7/63371: 32% mana arcane_charge, clearcasting, rune_of_power, potion_of_deathly_fixation
5:20.045 aoe o arcane_explosion Fluffy_Pillow 21768.7/63371: 34% mana arcane_charge(2), rune_of_power, potion_of_deathly_fixation
5:21.352 aoe o arcane_explosion Fluffy_Pillow 18425.3/63371: 29% mana arcane_charge(3), rune_of_power, potion_of_deathly_fixation
5:22.657 aoe p arcane_barrage Fluffy_Pillow 15079.2/63371: 24% mana arcane_charge(4), clearcasting, rune_of_power, potion_of_deathly_fixation
5:23.965 aoe o arcane_explosion Fluffy_Pillow 19271.9/63371: 30% mana clearcasting, rune_of_power, potion_of_deathly_fixation
5:25.274 aoe o arcane_explosion Fluffy_Pillow 20931.0/63371: 33% mana arcane_charge, rune_of_power, potion_of_deathly_fixation
5:26.580 aoe o arcane_explosion Fluffy_Pillow 17586.2/63371: 28% mana arcane_charge(2), rune_of_power, potion_of_deathly_fixation
5:27.886 aoe o arcane_explosion Fluffy_Pillow 14241.5/63371: 22% mana arcane_charge(3), rune_of_power
5:29.192 aoe n shifting_power Fluffy_Pillow 10896.7/63371: 17% mana arcane_charge(4)
5:33.013 aoe p arcane_barrage Fluffy_Pillow 13239.6/63371: 21% mana arcane_charge(4)

Stats

Level Bonus (60) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 198 1 199 199 0
Agility 306 2 308 308 0
Stamina 414 0 434 414 0
Intellect 450 -3 2453 2247 1800
Spirit 0 0 0 0 0
Health 8680 8280 0
Mana 63371 63371 0
Spell Power 2453 2247 0
Crit 19.29% 19.29% 500
Haste 15.15% 15.15% 500
Versatility 12.50% 12.50% 500
Mana Regen 1267 1267 0
Mastery 26.74% 26.74% 500
Armor 0 0 0
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 0.00

Profile

mage="Night_Fae"
source=default
spec=arcane
level=60
race=troll
role=spell
position=back
talents=1032021
covenant=night_fae

# Default consumables
potion=deathly_fixation
flask=spectral_flask_of_power
food=feast_of_gluttonous_hedonism
augmentation=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=variable,name=prepull_evo,op=reset,default=0
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
actions.precombat+=/variable,name=have_opened,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
actions.precombat+=/variable,name=final_burn,op=set,value=0
actions.precombat+=/variable,name=rs_max_delay,op=reset,default=5
actions.precombat+=/variable,name=ap_max_delay,op=reset,default=10
actions.precombat+=/variable,name=rop_max_delay,op=reset,default=20
actions.precombat+=/variable,name=totm_max_delay,op=reset,default=5
actions.precombat+=/variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
actions.precombat+=/variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
actions.precombat+=/variable,name=barrage_mana_pct,op=reset,default=70
actions.precombat+=/variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=reset,default=30
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
actions.precombat+=/variable,name=totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=aoe_totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=am_spam,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
actions.precombat+=/variable,name=am_spam_evo_pct,op=reset,default=15
actions.precombat+=/flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/arcane_familiar
actions.precombat+=/arcane_intellect
actions.precombat+=/conjure_mana_gem
actions.precombat+=/snapshot_stats
actions.precombat+=/mirror_image
actions.precombat+=/frostbolt,if=variable.prepull_evo<=0
actions.precombat+=/evocation,if=variable.prepull_evo>0

# Executed every time the actor is available.
actions=counterspell,if=target.debuff.casting.react
actions+=/call_action_list,name=shared_cds
actions+=/call_action_list,name=essences
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/call_action_list,name=opener,if=variable.have_opened<=0
actions+=/call_action_list,name=am_spam,if=variable.am_spam=1
actions+=/call_action_list,name=cooldowns
actions+=/call_action_list,name=rotation,if=variable.final_burn=0
actions+=/call_action_list,name=final_burn,if=variable.final_burn=1
actions+=/call_action_list,name=movement

actions.am_spam=cancel_action,if=action.evocation.channeling&mana.pct>=95
actions.am_spam+=/evocation,if=mana.pct<=variable.am_spam_evo_pct&(cooldown.touch_of_the_magi.remains<=action.evocation.execute_time|cooldown.arcane_power.remains<=action.evocation.execute_time|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=action.evocation.execute_time))&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/rune_of_power,if=buff.rune_of_power.down&cooldown.arcane_power.remains>0
actions.am_spam+=/touch_of_the_magi,if=(cooldown.arcane_power.remains=0&buff.rune_of_power.down)|prev_gcd.1.rune_of_power
actions.am_spam+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&buff.rune_of_power.down&essence.vision_of_perfection.enabled
actions.am_spam+=/arcane_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.ap_max_delay
actions.am_spam+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=action.arcane_missiles.execute_time&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_barrage,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_missiles,if=buff.clearcasting.react,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/arcane_missiles,if=!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/evocation,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.am_spam+=/arcane_barrage
actions.am_spam+=/arcane_blast

actions.aoe=frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
actions.aoe+=/arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
actions.aoe+=/mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
actions.aoe+=/arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
actions.aoe+=/rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
actions.aoe+=/presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
actions.aoe+=/arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
actions.aoe+=/supernova
actions.aoe+=/arcane_orb,if=buff.arcane_charge.stack=0
actions.aoe+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
actions.aoe+=/arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1

# Prioritize using grisly icicle with ap. Use it with totm otherwise.
actions.cooldowns=frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.cooldowns+=/frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/fire_blast,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt
# Always use mirrors with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/mirrors_of_torment,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/mirrors_of_torment,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Always use deathborne with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/deathborne,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/deathborne,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use spark if totm and ap are on cd and won't be up for longer than the max delay, making sure we have at least two arcane charges and that totm wasn't just used.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack>2&debuff.touch_of_the_magi.down
# Use spark with ap when possible. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/radiant_spark,if=cooldown.arcane_power.remains=0&((!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct)
actions.cooldowns+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&essence.vision_of_perfection.minor
# Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken. Hold a bit to make sure we can RS immediately after totm ends
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8
# Non-Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken.
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
# Use ap if totm is on cd and won't be up for longer than the max delay, making sure that we have enough mana and that there is not already a rune of power down.
actions.cooldowns+=/arcane_power,if=(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use rop if totm is on cd and won't be up for longer than the max delay, making sure there isn't already a rune down and that ap won't become available during rune.
actions.cooldowns+=/rune_of_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.rop_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
# Kyrian: RS is mana hungry and AB4s are too expensive to use pom to squeeze an extra ab in the totm window. Let's use it to make low charge ABs instant.
actions.cooldowns+=/presence_of_mind,if=buff.arcane_charge.stack=0&covenant.kyrian.enabled
# Non-Kyrian: Use pom to squeeze an extra ab in the totm window.
actions.cooldowns+=/presence_of_mind,if=debuff.touch_of_the_magi.up&!covenant.kyrian.enabled

actions.essences=blood_of_the_enemy,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/blood_of_the_enemy,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains>=50&cooldown.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay
actions.essences+=/worldvein_resonance,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/guardian_of_azeroth,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/guardian_of_azeroth,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/concentrated_flame,line_cd=6,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/reaping_flames,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/focused_azerite_beam,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/purifying_blast,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/ripple_in_space,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/the_unbound_force,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/memory_of_lucid_dreams,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down

actions.final_burn=arcane_missiles,if=buff.clearcasting.react,chain=1
actions.final_burn+=/arcane_blast
actions.final_burn+=/arcane_barrage

actions.movement=blink_any,if=movement.distance>=10
actions.movement+=/presence_of_mind
actions.movement+=/arcane_missiles,if=movement.distance<10
actions.movement+=/arcane_orb
actions.movement+=/fire_blast

actions.opener=variable,name=have_opened,op=set,value=1,if=prev_gcd.1.evocation
actions.opener+=/fire_blast,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command_frost.up
actions.opener+=/frost_nova,if=runeforge.grisly_icicle.equipped&mana.pct>95
actions.opener+=/mirrors_of_torment
actions.opener+=/deathborne
actions.opener+=/radiant_spark,if=mana.pct>40
actions.opener+=/cancel_action,if=action.shifting_power.channeling&gcd.remains=0
actions.opener+=/shifting_power,if=soulbind.field_of_blossoms.enabled
actions.opener+=/touch_of_the_magi
actions.opener+=/arcane_power
actions.opener+=/rune_of_power,if=buff.rune_of_power.down
actions.opener+=/presence_of_mind
actions.opener+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.opener+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.opener+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.opener+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.opener+=/arcane_missiles,if=buff.clearcasting.react,chain=1
actions.opener+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges&(cooldown.arcane_power.remains>10|active_enemies<=2)
actions.opener+=/arcane_blast,if=buff.rune_of_power.up|mana.pct>15
actions.opener+=/evocation,if=buff.rune_of_power.down,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.opener+=/arcane_barrage

actions.rotation=variable,name=final_burn,op=set,value=1,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&!buff.rule_of_threes.up&fight_remains<=((mana%action.arcane_blast.cost)*action.arcane_blast.execute_time)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&cooldown.arcane_power.remains<=gcd)
actions.rotation+=/strict_sequence,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&buff.arcane_power.down&buff.rune_of_power.down,name=last_spark_stack:arcane_blast:arcane_barrage
actions.rotation+=/arcane_barrage,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&(buff.arcane_power.down|buff.arcane_power.remains<=gcd)&(buff.rune_of_power.down|buff.rune_of_power.remains<=gcd)
actions.rotation+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.rotation+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.rotation+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&(debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time|cooldown.presence_of_mind.remains>0|covenant.kyrian.enabled)&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.expanded_potential.up
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&(buff.arcane_power.up|buff.rune_of_power.up|debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.stack=buff.clearcasting.max_stack,chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.remains<=((buff.clearcasting.stack*action.arcane_missiles.execute_time)+gcd),chain=1
actions.rotation+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges
actions.rotation+=/supernova,if=mana.pct<=95&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.evocation.remains>0&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.rotation+=/arcane_blast,if=buff.rule_of_threes.up&buff.arcane_charge.stack>3
actions.rotation+=/arcane_barrage,if=mana.pct<variable.barrage_mana_pct&cooldown.evocation.remains>0&buff.arcane_power.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&essence.vision_of_perfection.minor
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(cooldown.rune_of_power.remains=0|cooldown.arcane_power.remains=0)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=mana.pct<=variable.barrage_mana_pct&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&talent.arcane_orb.enabled&cooldown.arcane_orb.remains<=gcd&mana.pct<=90&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.rune_of_power.up&buff.rune_of_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_blast
actions.rotation+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.rotation+=/arcane_barrage

actions.shared_cds=use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
actions.shared_cds+=/use_items,if=buff.arcane_power.up
actions.shared_cds+=/potion,if=buff.arcane_power.up
actions.shared_cds+=/time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
actions.shared_cds+=/lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/berserking,if=buff.arcane_power.up
actions.shared_cds+=/blood_fury,if=buff.arcane_power.up
actions.shared_cds+=/fireblood,if=buff.arcane_power.up
actions.shared_cds+=/ancestral_call,if=buff.arcane_power.up


# Gear Summary
# gear_ilvl=0.00
# gear_intellect=1800
# gear_crit_rating=500
# gear_haste_rating=500
# gear_mastery_rating=500
# gear_versatility_rating=500

Venthyr : 11049 dps, 4740 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
11049.1 11049.1 20.4 / 0.185% 1164.7 / 10.5% 5.4
RPS Out RPS In Primary Resource Waiting APM Active Skill
2041.5 1947.3 Mana 0.00% 49.4 100.0% 100%
Talents
Venthyr

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Venthyr 11049
Arcane Barrage 3988 36.1% 57.1 5.28sec 21066 16883 Direct 171.2 5905 11784 7035 19.2%

Stats Details: Arcane Barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 57.14 171.19 0.00 0.00 1.2478 0.0000 1203706.20 1203706.20 0.00% 16882.99 16882.99
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.76% 138.25 101 174 5904.56 2082 25140 5893.87 5084 6464 816083 816083 0.00%
crit 19.24% 32.94 15 54 11783.70 4164 50280 11754.17 7735 17207 387623 387623 0.00%

Action Details: Arcane Barrage

  • id:44425
  • school:arcane
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:3.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.728000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:44425
  • name:Arcane Barrage
  • school:arcane
  • tooltip:
  • description:Launches bolts of arcane energy at the enemy target, causing {$s1=0 + 72.8%} Arcane damage. For each Arcane Charge, deals {$36032s2=30}% additional damage$?a321526[, grants you {$321526s1=2}% of your maximum mana,][]$?a231564[ and hits {$36032s3=0} additional nearby $Ltarget:targets; for {$s2=40}% of its damage][]. |cFFFFFFFFConsumes all Arcane Charges.|r

Action Priority List

    aoe
    [p]:57.14
  • if_expr:buff.arcane_charge.stack=buff.arcane_charge.max_stack
Arcane Echo 271 2.4% 42.7 6.65sec 1912 0 Direct 128.0 534 1069 637 19.3%

Stats Details: Arcane Echo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 42.67 128.00 0.00 0.00 0.0000 0.0000 81581.27 81581.27 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.68% 103.27 72 132 534.20 316 664 533.83 493 579 55153 55153 0.00%
crit 19.32% 24.73 11 42 1068.88 633 1329 1068.24 922 1223 26428 26428 0.00%

Action Details: Arcane Echo

  • id:342232
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.109200
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:342232
  • name:Arcane Echo
  • school:arcane
  • tooltip:
  • description:{$@spelldesc342231=Direct damage you deal to enemies affected by Touch of the Magi, causes an explosion that deals {$342232s1=0 + 10.9%} Arcane damage to {$s1=8} nearby enemies.}
Arcane Explosion 5111 46.2% 154.0 1.93sec 10003 8052 Direct 461.9 2796 5584 3335 19.4%

Stats Details: Arcane Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 153.96 461.89 0.00 0.00 1.2423 0.0000 1540102.54 1540102.54 0.00% 8051.81 8051.81
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.64% 372.45 282 461 2795.54 2128 4469 2795.61 2686 2936 1040964 1040964 0.00%
crit 19.36% 89.43 55 125 5583.57 4256 8938 5581.19 5031 6149 499139 499139 0.00%

Action Details: Arcane Explosion

  • id:1449
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:5000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.546000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:1449
  • name:Arcane Explosion
  • school:arcane
  • tooltip:
  • description:Causes an explosion of magic around the caster, dealing {$s2=0 + 54.6%} Arcane damage to all enemies within $A2 yards.$?a137021[ |cFFFFFFFFGenerates {$s1=1} Arcane Charge if any targets are hit.|r][]

Action Priority List

    aoe
    [o]:153.95
  • if_expr:buff.arcane_charge.stack<buff.arcane_charge.max_stack
Arcane Orb 0 (845) 0.0% (7.6%) 13.2 23.45sec 19257 15439

Stats Details: Arcane Orb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 13.22 0.00 0.00 0.00 1.2473 0.0000 0.00 0.00 0.00% 15439.31 15439.31

Action Details: Arcane Orb

  • id:153626
  • school:arcane
  • range:40.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Spelldata

  • id:153626
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r

Action Priority List

    aoe
    [n]:13.21
  • if_expr:buff.arcane_charge.stack=0
    Arcane Orb (_bolt) 845 7.6% 39.6 23.45sec 6427 0 Direct 39.6 5387 10818 6426 19.2%

Stats Details: Arcane Orb Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 39.60 39.60 0.00 0.00 0.0000 0.0000 254486.18 254486.18 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.83% 32.01 20 46 5387.05 3869 8126 5387.91 4734 5919 172356 172356 0.00%
crit 19.17% 7.59 1 16 10817.82 7739 16251 10845.12 7739 16251 82130 82130 0.00%

Action Details: Arcane Orb Bolt

  • id:153640
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.092000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:153640
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:{$@spelldesc153626=Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r}
Deathly Fixation 0 (69) 0.0% (0.6%) 14.7 1.78sec 1390 0

Stats Details: Deathly Fixation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.71 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Deathly Fixation

  • id:322253
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:42.90
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:322253
  • name:Deathly Fixation
  • school:shadow
  • tooltip:Taking $w1 Shadow damage every $t1.
  • description:Deal {$s1=43} Shadow damage every $t1. Stacks up to 5 times.
    Deathly Eruption 69 0.6% 14.7 1.78sec 1390 0 Direct 14.7 1164 2327 1390 19.5%

Stats Details: Deathly Eruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.71 14.71 0.00 0.00 0.0000 0.0000 20443.29 20443.29 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.55% 11.85 6 19 1163.53 1164 1164 1163.53 1164 1164 13785 13785 0.00%
crit 19.45% 2.86 0 9 2327.06 2327 2327 2233.53 0 2327 6658 6658 0.00%

Action Details: Deathly Eruption

  • id:322256
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:984.99
  • base_dd_max:984.99
  • base_dd_mult:1.00

Spelldata

  • id:322256
  • name:Deathly Eruption
  • school:shadow
  • tooltip:
  • description:Deal {$s1=985} Shadow damage.
Frostbolt 6 0.1% 0.0 0.00sec 0 0 Direct 1.0 1481 2961 1755 18.8%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 1.00 0.00 0.00 0.0000 0.0000 1758.42 1758.42 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.24% 0.81 0 1 1480.68 1481 1481 1202.94 0 1481 1203 1203 0.00%
crit 18.76% 0.19 0 1 2961.35 2961 2961 555.48 0 2961 555 555 0.00%

Action Details: Frostbolt

  • id:116
  • school:frost
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.511000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116
  • name:Frostbolt
  • school:frost
  • tooltip:
  • description:Launches a bolt of frost at the enemy, causing {$228597s1=0} Frost damage and slowing movement speed by {$205708s1=50}% for {$205708d=8 seconds}.
Mirror Image 0 (20) 0.0% (0.2%) 1.0 0.00sec 6091 0

Stats Details: Mirror Image

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Mirror Image

  • id:55342
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:55342
  • name:Mirror Image
  • school:arcane
  • tooltip:Damage taken is reduced by {$s3=20}% while your images are active.
  • description:Creates {$s2=3} copies of you nearby for {$55342d=40 seconds}, which cast spells and attack your enemies. While your images are active damage taken is reduced by {$s3=20}%, taking direct damage will cause one of your images to dissipate.
    Frostbolt (mirror_image) 152  / 20 0.2% 90.0 1.29sec 68 52 Direct 90.0 57 113 68 19.2%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 90.00 90.00 0.00 0.00 1.3087 0.0000 6091.21 6091.21 0.00% 51.72 51.72
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.82% 72.74 60 83 56.82 43 60 56.82 56 58 4133 4133 0.00%
crit 19.18% 17.26 7 30 113.45 86 120 113.43 103 120 1959 1959 0.00%

Action Details: Frostbolt

  • id:59638
  • school:frost
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.027000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:59638
  • name:Frostbolt
  • school:frost
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for {$d=4 seconds}.

Action Priority List

    default
    [ ]:31.00
Mirrors of Torment 0 (145) 0.0% (1.3%) 2.7 138.68sec 16242 12435

Stats Details: Mirrors Of Torment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.69 0.00 0.00 0.00 1.3065 0.0000 0.00 0.00 0.00% 12435.10 12435.10

Action Details: Mirrors Of Torment

  • id:314793
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:314793
  • name:Mirrors of Torment
  • school:shadow
  • tooltip:Attacking, casting a spell or ability, consumes a mirror to inflict Shadow damage and reduce cast and movement speed by {$320035s3=15}%. Your final mirror will instead Root and Silence you for {$317589d=4 seconds}.
  • description:Conjure $n mirrors to torment the enemy for {$d=25 seconds}. Whenever the target attacks, casts a spell, or uses an ability, a mirror is consumed to inflict {$320035s1=0} Shadow damage and their movement and cast speed are slowed by {$320035s3=15}%. This effect cannot be triggered more often than once per {$345977d=6 seconds}. The final mirror will instead inflict {$317589s1=0} Shadow damage to the enemy, Rooting and Silencing them for {$317589d=4 seconds}. Whenever a mirror is consumed $?c1[you gain {$345417s1=4}% mana][]$?c2[your Fire Blast cooldown is reduced by {$s2=4} sec][]$?c3[you gain Brain Freeze][].

Action Priority List

    aoe
    [j]:2.70
  • if_expr:(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
    Agonizing Backlash 64 0.6% 5.3 55.70sec 3625 0 Direct 5.3 3061 6134 3628 18.3%

Stats Details: Agonizing Backlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.30 5.30 0.00 0.00 0.0000 0.0000 19227.12 19227.12 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.68% 4.33 1 6 3061.47 1739 3651 3050.38 1739 3651 13258 13258 0.00%
crit 18.32% 0.97 0 4 6133.74 3477 7302 3885.55 0 7302 5969 5969 0.00%

Action Details: Agonizing Backlash

  • id:320035
  • school:shadow
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:320035
  • name:Agonizing Backlash
  • school:shadow
  • tooltip:Movement speed and cast speed slowed by {$s3=15}%.
  • description:{$@spelldesc314793=Conjure $n mirrors to torment the enemy for {$d=25 seconds}. Whenever the target attacks, casts a spell, or uses an ability, a mirror is consumed to inflict {$320035s1=0} Shadow damage and their movement and cast speed are slowed by {$320035s3=15}%. This effect cannot be triggered more often than once per {$345977d=6 seconds}. The final mirror will instead inflict {$317589s1=0} Shadow damage to the enemy, Rooting and Silencing them for {$317589d=4 seconds}. Whenever a mirror is consumed $?c1[you gain {$345417s1=4}% mana][]$?c2[your Fire Blast cooldown is reduced by {$s2=4} sec][]$?c3[you gain Brain Freeze][].}
    Tormenting Backlash 81 0.7% 2.6 139.64sec 9508 0 Direct 2.6 8024 16186 9525 18.2%

Stats Details: Tormenting Backlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.58 2.58 0.00 0.00 0.0000 0.0000 24494.70 24494.70 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.80% 2.11 0 3 8023.69 6126 9188 7829.77 0 9188 16907 16907 0.00%
crit 18.20% 0.47 0 3 16185.62 12251 18377 6268.54 0 18377 7588 7588 0.00%

Action Details: Tormenting Backlash

  • id:317589
  • school:shadow
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.510000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:317589
  • name:Tormenting Backlash
  • school:shadow
  • tooltip:Rooted and Silenced.
  • description:{$@spelldesc314793=Conjure $n mirrors to torment the enemy for {$d=25 seconds}. Whenever the target attacks, casts a spell, or uses an ability, a mirror is consumed to inflict {$320035s1=0} Shadow damage and their movement and cast speed are slowed by {$320035s3=15}%. This effect cannot be triggered more often than once per {$345977d=6 seconds}. The final mirror will instead inflict {$317589s1=0} Shadow damage to the enemy, Rooting and Silencing them for {$317589d=4 seconds}. Whenever a mirror is consumed $?c1[you gain {$345417s1=4}% mana][]$?c2[your Fire Blast cooldown is reduced by {$s2=4} sec][]$?c3[you gain Brain Freeze][].}
Touch of the Magi 0 (594) 0.0% (5.4%) 6.1 53.26sec 29482 23453

Stats Details: Touch Of The Magi

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.07 0.00 0.00 0.00 1.2570 0.0000 0.00 0.00 0.00% 23453.08 23453.08

Action Details: Touch Of The Magi

  • id:321507
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:4.0

Spelldata

  • id:321507
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]

Action Priority List

    aoe
    [k]:6.08
  • if_expr:buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
    Touch of the Magi (_explosion) 594 5.4% 6.1 53.16sec 29482 0 Direct 18.2 9853 0 9853 0.0%

Stats Details: Touch Of The Magi Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.07 18.17 0.00 0.00 0.0000 0.0000 178900.10 178900.10 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 18.17 15 21 9852.55 297 40306 9836.77 6735 12716 178900 178900 0.00%

Action Details: Touch Of The Magi Explosion

  • id:210833
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:7833.85
  • base_dd_max:7833.85
  • base_dd_mult:1.00

Spelldata

  • id:210833
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:{$@spelldesc321507=Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]}
Simple Action Stats Execute Interval
Venthyr
Arcane Power 2.8 129.11sec

Stats Details: Arcane Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.84 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Arcane Power

  • id:12042
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:12042
  • name:Arcane Power
  • school:arcane
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].

Action Priority List

    aoe
    [l]:2.84
  • if_expr:((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
Berserking 1.8 258.14sec

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.84 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    shared_cds
    [t]:1.84
  • if_expr:buff.arcane_power.up
Conjure Mana Gem 1.0 0.00sec

Stats Details: Conjure Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Conjure Mana Gem

  • id:759
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:9000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:759
  • name:Conjure Mana Gem
  • school:arcane
  • tooltip:
  • description:Conjures a Mana Gem that can be used to instantly restore {$5405s1=10}% mana, and holds up to {$s2=3} charges. $@spellname118812 {$@spelldesc118812=Conjured items disappear if logged out for more than 15 minutes.}
Evocation 1.0 174.44sec

Stats Details: Evocation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.02 0.00 6.09 0.00 4.3109 0.7223 0.00 0.00 0.00% 0.00 0.00

Action Details: Evocation

  • id:12051
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Venthyr
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:12051
  • name:Evocation
  • school:arcane
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.

Action Priority List

    aoe
    [q]:1.02
  • interrupt_if_expr:mana.pct>=85
Spectral Flask of Power (flask) 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:307185
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Venthyr
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of Gluttonous Hedonism (food) 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:308462
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Venthyr
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Potion of Deathly Fixation (potion) 1.0 0.00sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:307497
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    shared_cds
    [s]:1.00
  • if_expr:buff.arcane_power.up
Rune of Power 5.9 51.99sec

Stats Details: Rune Of Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.89 0.00 0.00 0.00 1.2556 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Rune Of Power

  • id:116011
  • school:arcane
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:116011
  • name:Rune of Power
  • school:arcane
  • tooltip:
  • description:Places a Rune of Power on the ground for {$116011d=15 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.

Action Priority List

    aoe
    [m]:5.91
  • if_expr:buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
Replenish Mana (use_mana_gem) 2.7 124.63sec

Stats Details: Use Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.73 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Use Mana Gem

  • id:5405
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Venthyr
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5405
  • name:Replenish Mana
  • school:physical
  • tooltip:Restoring $w2 mana every $t1 sec.
  • description:Restores {$s1=10}% mana.

Action Priority List

    shared_cds
    [r]:2.73
  • if_expr:(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Arcane Charge 57.9 155.0 5.2sec 1.4sec 3.8sec 73.07% 0.00% 0.6 (0.7) 0.0

Buff Details

  • buff initial source:Venthyr
  • cooldown name:buff_arcane_charge
  • max_stacks:4
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 13.5s
  • trigger_min/max:0.0s / 8.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 9.6s

Stack Uptimes

  • arcane_charge_1:18.92%
  • arcane_charge_2:16.22%
  • arcane_charge_3:16.53%
  • arcane_charge_4:21.40%

Spelldata

  • id:36032
  • name:Arcane Charge
  • tooltip:Increases the damage of Arcane Blast, Arcane Missiles, Arcane Explosion, and Arcane Barrage by $36032w1%. Increases the mana cost of Arcane Blast by $36032w2%$?{$w5<0}[, and reduces the cast time of Arcane Blast by $w5%.][.] Increases the number of targets hit by Arcane Barrage for 50% damage by $36032w3.
  • description:$@spelldesc114664
  • max_stacks:4
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Arcane Power 2.8 0.0 129.2sec 129.2sec 14.7sec 13.83% 0.00% 0.0 (0.0) 2.7

Buff Details

  • buff initial source:Venthyr
  • cooldown name:buff_arcane_power
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:121.7s / 139.3s
  • trigger_min/max:121.7s / 139.3s
  • trigger_pct:100.00%
  • duration_min/max:0.3s / 15.0s

Stack Uptimes

  • arcane_power_1:13.83%

Spelldata

  • id:12042
  • name:Arcane Power
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
Berserking 1.8 0.0 258.4sec 258.4sec 11.7sec 7.09% 23.66% 0.0 (0.0) 1.7

Buff Details

  • buff initial source:Venthyr
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:250.2s / 268.5s
  • trigger_min/max:250.2s / 268.5s
  • trigger_pct:100.00%
  • duration_min/max:0.3s / 12.0s

Stack Uptimes

  • berserking_1:7.09%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.45% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Venthyr
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.45%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Clearcasting 24.6 0.2 11.8sec 11.8sec 2.0sec 16.36% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Venthyr
  • cooldown name:buff_clearcasting
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stack Uptimes

  • clearcasting_1:16.15%
  • clearcasting_2:0.21%
  • clearcasting_3:0.04%

Spelldata

  • id:263725
  • name:Clearcasting
  • tooltip:Your next Arcane Missiles or Arcane Explosion costs no mana{$?s321758=false}[ and Arcane Missiles fires an additional missile][].
  • description:{$@spelldesc79684=For each ${$c*100/{$s1=200}} mana you spend, you have a 1% chance to gain Clearcasting, making your next Arcane Missiles or Arcane Explosion free and channel {$277726s1=20}% faster.$?a321758[ Arcane Missiles fires {$321758s2=1} additional missile.][]}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Evocation 1.0 0.0 164.9sec 164.9sec 4.3sec 1.47% 0.00% 4.1 (4.1) 0.0

Buff Details

  • buff initial source:Venthyr
  • cooldown name:buff_evocation
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:7.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:1.00

Trigger Details

  • interval_min/max:102.3s / 259.1s
  • trigger_min/max:102.3s / 259.1s
  • trigger_pct:100.00%
  • duration_min/max:0.3s / 4.3s

Stack Uptimes

  • evocation_1:1.47%

Spelldata

  • id:12051
  • name:Evocation
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Deathly Fixation 1.0 0.0 0.0sec 0.0sec 25.0sec 8.40% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Venthyr
  • cooldown name:buff_potion_of_deathly_fixation
  • max_stacks:1
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:25.0s / 25.0s

Stack Uptimes

  • potion_of_deathly_fixation_1:8.40%

Spelldata

  • id:307497
  • name:Potion of Deathly Fixation
  • tooltip:Chance to apply Deathly Fixation to your target.
  • description:Your damaging spells and abilities have a chance to apply Deathly Fixation to your target, dealing {$322253s1=43} Shadow damage over {$322253d=8 seconds} and stacking up to 5 times. Upon reaching 5 stacks, Deathly Fixation explodes, dealing {$322256s1=985} Shadow damage to the target. If you consume this potion while your weapon is augmented with Shadowcore Oil, the explosion damage is increased by {$s2=10}%. Lasts {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Rune of Power 8.7 0.0 36.0sec 36.0sec 14.7sec 42.51% 0.00% 0.0 (0.0) 8.4

Buff Details

  • buff initial source:Venthyr
  • cooldown name:buff_rune_of_power
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.40
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:15.7s / 56.6s
  • trigger_min/max:15.7s / 56.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • rune_of_power_1:42.51%

Spelldata

  • id:116014
  • name:Rune of Power
  • tooltip:Spell damage increased by $w1%.$?$w2=0[][ Health restored by $w2% per second.]
  • description:{$@spelldesc116011=Places a Rune of Power on the ground for {$116011d=15 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Well Fed (feast_of_gluttonous_hedonism)

Buff Details

  • buff initial source:Venthyr
  • cooldown name:buff_feast_of_gluttonous_hedonism
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327708
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=20}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Spectral Flask of Power

Buff Details

  • buff initial source:Venthyr
  • cooldown name:buff_spectral_flask_of_power
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:307185
  • name:Spectral Flask of Power
  • tooltip:$pri increased by $w1.
  • description:Increases $pri by {$s1=70} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs, Uptimes & Benefits

Benefit Avg % Min Max
Arcane Barrage Arcane Charge 4 100.00% 100.00% 100.00%
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 2.92% 0.80% 8.14% 0.9s 0.0s 4.7s
Conserve Phase 100.00% 100.00% 100.00% 301.4s 240.2s 359.7s

Cooldown waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Mirror Image0.0000.0000.000181.465120.158239.654
Evocation152.51912.332320.876224.726132.001359.654
Rune of Power7.5621.14428.61546.83526.61760.469
Touch of the Magi6.0470.00027.54639.05225.31157.064
Arcane Power6.7581.68419.32519.6384.94730.765
Arcane Barrage2.7800.0028.279159.856124.803192.609
Arcane Orb3.4510.01410.48545.94431.37759.642
Mirrors of Torment29.2120.00074.53286.58462.343145.277

Burn Phases

Burn phase duration tracks the amount of time spent in each burn phase. This is defined as the time between a start_burn_phase and stop_burn_phase action being executed. Note that "execute" burn phases, i.e., the final burn of a fight, is also included.

Burn Phase Duration
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Mana at burn start is the mana level recorded (in percentage of total mana) when a start_burn_phase command is executed.

Mana at Burn Start
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
Venthyr
mana_regen Mana 525.25 367926.31 62.67% 700.47 13471.21 3.53%
Evocation Mana 48.75 49025.20 8.35% 1005.71 0.00 0.00%
Mana Gem Mana 2.73 17330.61 2.95% 6337.14 0.00 0.00%
Arcane Barrage Mana 57.14 136883.12 23.32% 2395.78 7945.96 5.49%
Mirrors of Torment Mana 7.89 15881.54 2.71% 2013.46 4112.64 20.57%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 62371.4 1947.34 2041.54 25543.3 34973.1 135.7 63371.4
Usage Type Count Total Avg RPE APR
Venthyr
arcane_explosion Mana 154.0 587885.3 3818.6 3818.4 2.6
arcane_orb Mana 13.2 5914.0 447.6 447.5 43.0
mirrors_of_torment Mana 2.7 5385.9 2000.0 2000.8 8.1
touch_of_the_magi Mana 6.1 15167.3 2500.0 2499.5 11.8

Statistics & Data Analysis

Fight Length
Venthyr Fight Length
Count 821
Mean 301.46
Minimum 240.16
Maximum 359.65
Spread ( max - min ) 119.50
Range [ ( max - min ) / 2 * 100% ] 19.82%
DPS
Venthyr Damage Per Second
Count 821
Mean 11049.09
Minimum 10214.82
Maximum 11888.99
Spread ( max - min ) 1674.17
Range [ ( max - min ) / 2 * 100% ] 7.58%
Standard Deviation 298.3771
5th Percentile 10552.30
95th Percentile 11550.06
( 95th Percentile - 5th Percentile ) 997.76
Mean Distribution
Standard Deviation 10.4134
95.00% Confidence Interval ( 11028.69 - 11069.50 )
Normalized 95.00% Confidence Interval ( 99.82% - 100.18% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 29
0.1% Error 2802
0.1 Scale Factor Error with Delta=300 761
0.05 Scale Factor Error with Delta=300 3041
0.01 Scale Factor Error with Delta=300 76001
Priority Target DPS
Venthyr Priority Target Damage Per Second
Count 821
Mean 4740.27
Minimum 4193.47
Maximum 5279.55
Spread ( max - min ) 1086.08
Range [ ( max - min ) / 2 * 100% ] 11.46%
Standard Deviation 174.9713
5th Percentile 4462.28
95th Percentile 5025.76
( 95th Percentile - 5th Percentile ) 563.48
Mean Distribution
Standard Deviation 6.1065
95.00% Confidence Interval ( 4728.30 - 4752.24 )
Normalized 95.00% Confidence Interval ( 99.75% - 100.25% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 53
0.1% Error 5234
0.1 Scale Factor Error with Delta=300 262
0.05 Scale Factor Error with Delta=300 1046
0.01 Scale Factor Error with Delta=300 26135
DPS(e)
Venthyr Damage Per Second (Effective)
Count 821
Mean 11049.09
Minimum 10214.82
Maximum 11888.99
Spread ( max - min ) 1674.17
Range [ ( max - min ) / 2 * 100% ] 7.58%
Damage
Venthyr Damage
Count 821
Mean 3324699.81
Minimum 2492357.50
Maximum 4034211.45
Spread ( max - min ) 1541853.95
Range [ ( max - min ) / 2 * 100% ] 23.19%
DTPS
Venthyr Damage Taken Per Second
Count 821
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Venthyr Healing Per Second
Count 821
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Venthyr Healing Per Second (Effective)
Count 821
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Venthyr Heal
Count 821
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Venthyr Healing Taken Per Second
Count 821
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Venthyr Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
VenthyrTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Venthyr Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 variable,name=prepull_evo,op=reset,default=0
1 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
2 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
3 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
4 0.00 variable,name=have_opened,op=reset,default=0
5 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
6 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
7 0.00 variable,name=final_burn,op=set,value=0
8 0.00 variable,name=rs_max_delay,op=reset,default=5
9 0.00 variable,name=ap_max_delay,op=reset,default=10
A 0.00 variable,name=rop_max_delay,op=reset,default=20
B 0.00 variable,name=totm_max_delay,op=reset,default=5
C 0.00 variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
D 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
E 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
F 0.00 variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
G 0.00 variable,name=barrage_mana_pct,op=reset,default=70
H 0.00 variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
I 0.00 variable,name=ap_minimum_mana_pct,op=reset,default=30
J 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
K 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
L 0.00 variable,name=totm_max_charges,op=reset,default=2
M 0.00 variable,name=aoe_totm_max_charges,op=reset,default=2
N 0.00 variable,name=am_spam,op=reset,default=0
O 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
P 0.00 variable,name=am_spam_evo_pct,op=reset,default=15
Q 0.00 flask
R 0.00 food
S 0.00 augmentation
T 0.00 arcane_familiar
U 0.00 arcane_intellect
V 0.00 conjure_mana_gem
W 0.00 snapshot_stats
X 0.00 mirror_image
Y 0.00 frostbolt,if=variable.prepull_evo<=0
Z 0.00 evocation,if=variable.prepull_evo>0
Default action list Executed every time the actor is available.
# count action,conditions
0.00 counterspell,if=target.debuff.casting.react
a 0.00 call_action_list,name=shared_cds
b 0.00 call_action_list,name=essences
c 0.00 call_action_list,name=aoe,if=active_enemies>2
d 0.00 call_action_list,name=opener,if=variable.have_opened<=0
e 0.00 call_action_list,name=am_spam,if=variable.am_spam=1
f 0.00 call_action_list,name=cooldowns
g 0.00 call_action_list,name=rotation,if=variable.final_burn=0
h 0.00 call_action_list,name=final_burn,if=variable.final_burn=1
i 0.00 call_action_list,name=movement
actions.aoe
# count action,conditions
0.00 frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
0.00 arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
j 2.70 mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
k 6.08 touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
l 2.84 arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
m 5.91 rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
0.00 presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
0.00 arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
0.00 supernova
n 13.21 arcane_orb,if=buff.arcane_charge.stack=0
0.00 nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
0.00 shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
o 153.95 arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
0.00 arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
p 57.14 arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
q 1.02 evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.shared_cds
# count action,conditions
r 2.73 use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
0.00 use_items,if=buff.arcane_power.up
s 1.00 potion,if=buff.arcane_power.up
0.00 time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
0.00 lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
0.00 bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
t 1.84 berserking,if=buff.arcane_power.up
0.00 blood_fury,if=buff.arcane_power.up
0.00 fireblood,if=buff.arcane_power.up
0.00 ancestral_call,if=buff.arcane_power.up

Sample Sequence

045789ABGILMNPQRVXYjklstpnpoooopoooopoooompoooopnpoooorpoooopoooopoooopnpoooopoooopkmpoooopnpoooopoooopoooopnpoooopoooopkmpoooqopnpoooolpoooopoooopnpoooopojkmpoooopnpoooopoooorpoooopnpoooopoooopkmpoooopnpoooopoooopoooopnpoooopoooopjkltpoooopnpoooopoooompoooopnpoooopooooproooopnpoooopoooopkmpo

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 prepull_evo Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 4 have_opened Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 5 have_opened Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 7 final_burn Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 8 rs_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 9 ap_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat A rop_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat B totm_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat G barrage_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat I ap_minimum_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat L totm_max_charges Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat M aoe_totm_max_charges Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat N am_spam Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat P am_spam_evo_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat Q flask Venthyr 63371.4/63371: 100% mana
Pre precombat R food Venthyr 63371.4/63371: 100% mana
Pre precombat V conjure_mana_gem Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat X mirror_image Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat Y frostbolt Fluffy_Pillow 63371.4/63371: 100% mana
0:00.000 aoe j mirrors_of_torment Fluffy_Pillow 62371.4/63371: 98% mana
0:01.307 aoe k touch_of_the_magi Fluffy_Pillow 61377.8/63371: 97% mana bloodlust
0:02.314 aoe l arcane_power Fluffy_Pillow 60154.1/63371: 95% mana bloodlust, arcane_charge(4)
0:02.314 shared_cds s potion Fluffy_Pillow 60154.1/63371: 95% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power
0:02.314 shared_cds t berserking Fluffy_Pillow 60154.1/63371: 95% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:02.314 aoe p arcane_barrage Fluffy_Pillow 60154.1/63371: 95% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:03.227 aoe n arcane_orb Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_power, rune_of_power, potion_of_deathly_fixation
0:04.142 aoe p arcane_barrage Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:05.056 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_power, rune_of_power, potion_of_deathly_fixation
0:05.970 aoe o arcane_explosion Fluffy_Pillow 62029.9/63371: 98% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, potion_of_deathly_fixation
0:06.886 aoe o arcane_explosion Fluffy_Pillow 60690.8/63371: 96% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, potion_of_deathly_fixation
0:07.800 aoe o arcane_explosion Fluffy_Pillow 59349.3/63371: 94% mana bloodlust, berserking, arcane_charge(3), arcane_power, rune_of_power, potion_of_deathly_fixation
0:08.715 aoe p arcane_barrage Fluffy_Pillow 58008.9/63371: 92% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:09.628 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_power, rune_of_power, potion_of_deathly_fixation
0:10.544 aoe o arcane_explosion Fluffy_Pillow 62032.4/63371: 98% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, potion_of_deathly_fixation
0:11.458 aoe o arcane_explosion Fluffy_Pillow 60690.8/63371: 96% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, potion_of_deathly_fixation
0:12.372 aoe o arcane_explosion Fluffy_Pillow 59349.3/63371: 94% mana bloodlust, berserking, arcane_charge(3), arcane_power, clearcasting, rune_of_power, potion_of_deathly_fixation
0:13.288 aoe p arcane_barrage Fluffy_Pillow 60510.2/63371: 95% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:14.203 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_power, rune_of_power, potion_of_deathly_fixation
0:15.117 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, arcane_charge, arcane_power, rune_of_power, potion_of_deathly_fixation
0:16.124 aoe o arcane_explosion Fluffy_Pillow 62147.7/63371: 98% mana bloodlust, arcane_charge(2), arcane_power, rune_of_power, potion_of_deathly_fixation
0:17.131 aoe o arcane_explosion Fluffy_Pillow 60924.0/63371: 96% mana bloodlust, arcane_charge(3), arcane_power, rune_of_power, potion_of_deathly_fixation
0:18.136 aoe m rune_of_power Fluffy_Pillow 59697.8/63371: 94% mana bloodlust, arcane_charge(4), clearcasting, potion_of_deathly_fixation
0:19.143 aoe p arcane_barrage Fluffy_Pillow 60974.1/63371: 96% mana bloodlust, arcane_charge(4), clearcasting, rune_of_power, potion_of_deathly_fixation
0:20.149 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, clearcasting, rune_of_power, potion_of_deathly_fixation
0:21.154 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, arcane_charge, rune_of_power, potion_of_deathly_fixation
0:22.159 aoe o arcane_explosion Fluffy_Pillow 59645.2/63371: 94% mana bloodlust, arcane_charge(2), rune_of_power, potion_of_deathly_fixation
0:23.166 aoe o arcane_explosion Fluffy_Pillow 55921.5/63371: 88% mana bloodlust, arcane_charge(3), clearcasting, rune_of_power, potion_of_deathly_fixation
0:24.172 aoe p arcane_barrage Fluffy_Pillow 57196.5/63371: 90% mana bloodlust, arcane_charge(4), rune_of_power, potion_of_deathly_fixation
0:25.179 aoe n arcane_orb Fluffy_Pillow 61007.7/63371: 96% mana bloodlust, rune_of_power, potion_of_deathly_fixation
0:26.187 aoe p arcane_barrage Fluffy_Pillow 61785.3/63371: 97% mana bloodlust, arcane_charge(4), rune_of_power, potion_of_deathly_fixation
0:27.194 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, rune_of_power, potion_of_deathly_fixation
0:28.199 aoe o arcane_explosion Fluffy_Pillow 59645.2/63371: 94% mana bloodlust, arcane_charge, clearcasting, rune_of_power
0:29.205 aoe o arcane_explosion Fluffy_Pillow 60920.2/63371: 96% mana bloodlust, arcane_charge(2), rune_of_power
0:30.213 aoe o arcane_explosion Fluffy_Pillow 57197.8/63371: 90% mana bloodlust, arcane_charge(3), rune_of_power
0:31.219 shared_cds r use_mana_gem Venthyr 53472.8/63371: 84% mana bloodlust, arcane_charge(4), clearcasting, rune_of_power
0:31.219 aoe p arcane_barrage Fluffy_Pillow 59810.0/63371: 94% mana bloodlust, arcane_charge(4), clearcasting, rune_of_power
0:32.223 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, clearcasting, rune_of_power
0:33.229 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, arcane_charge, rune_of_power
0:34.235 aoe o arcane_explosion Fluffy_Pillow 59646.5/63371: 94% mana bloodlust, arcane_charge(2), clearcasting
0:35.241 aoe o arcane_explosion Fluffy_Pillow 60921.5/63371: 96% mana bloodlust, arcane_charge(3)
0:36.248 aoe p arcane_barrage Fluffy_Pillow 57197.8/63371: 90% mana bloodlust, arcane_charge(4)
0:37.254 aoe o arcane_explosion Fluffy_Pillow 61007.7/63371: 96% mana bloodlust
0:38.260 aoe o arcane_explosion Fluffy_Pillow 57282.7/63371: 90% mana bloodlust, arcane_charge
0:39.266 aoe o arcane_explosion Fluffy_Pillow 53557.8/63371: 85% mana bloodlust, arcane_charge(2)
0:40.272 aoe o arcane_explosion Fluffy_Pillow 49832.8/63371: 79% mana bloodlust, arcane_charge(3), clearcasting
0:41.280 aoe p arcane_barrage Fluffy_Pillow 51110.4/63371: 81% mana arcane_charge(4)
0:42.584 aoe o arcane_explosion Fluffy_Pillow 55297.9/63371: 87% mana
0:43.892 aoe o arcane_explosion Fluffy_Pillow 51955.7/63371: 82% mana arcane_charge
0:45.199 aoe o arcane_explosion Fluffy_Pillow 48612.3/63371: 77% mana arcane_charge(2), clearcasting
0:46.507 aoe o arcane_explosion Fluffy_Pillow 50270.1/63371: 79% mana arcane_charge(3)
0:47.815 aoe p arcane_barrage Fluffy_Pillow 46927.9/63371: 74% mana arcane_charge(4)
0:49.121 aoe n arcane_orb Fluffy_Pillow 51118.0/63371: 81% mana
0:50.428 aoe p arcane_barrage Fluffy_Pillow 52274.5/63371: 82% mana arcane_charge(4)
0:51.734 aoe o arcane_explosion Fluffy_Pillow 56464.6/63371: 89% mana
0:53.041 aoe o arcane_explosion Fluffy_Pillow 53121.2/63371: 84% mana arcane_charge
0:54.348 aoe o arcane_explosion Fluffy_Pillow 49777.7/63371: 79% mana arcane_charge(2)
0:55.654 aoe o arcane_explosion Fluffy_Pillow 46432.9/63371: 73% mana arcane_charge(3)
0:56.960 aoe p arcane_barrage Fluffy_Pillow 43088.2/63371: 68% mana arcane_charge(4)
0:58.268 aoe o arcane_explosion Fluffy_Pillow 47280.9/63371: 75% mana
0:59.575 aoe o arcane_explosion Fluffy_Pillow 43937.4/63371: 69% mana arcane_charge
1:00.882 aoe o arcane_explosion Fluffy_Pillow 40593.9/63371: 64% mana arcane_charge(2)
1:02.188 aoe o arcane_explosion Fluffy_Pillow 37249.2/63371: 59% mana arcane_charge(3)
1:03.495 aoe p arcane_barrage Fluffy_Pillow 33905.7/63371: 54% mana arcane_charge(4)
1:04.801 aoe k touch_of_the_magi Fluffy_Pillow 38095.8/63371: 60% mana
1:06.107 aoe m rune_of_power Fluffy_Pillow 37251.1/63371: 59% mana arcane_charge(4)
1:07.414 aoe p arcane_barrage Fluffy_Pillow 38907.6/63371: 61% mana arcane_charge(4), rune_of_power
1:08.718 aoe o arcane_explosion Fluffy_Pillow 43095.2/63371: 68% mana rune_of_power
1:10.024 aoe o arcane_explosion Fluffy_Pillow 39750.5/63371: 63% mana arcane_charge, rune_of_power
1:11.329 aoe o arcane_explosion Fluffy_Pillow 36404.5/63371: 57% mana arcane_charge(2), rune_of_power
1:12.635 aoe o arcane_explosion Fluffy_Pillow 33059.7/63371: 52% mana arcane_charge(3), rune_of_power
1:13.942 aoe p arcane_barrage Fluffy_Pillow 29716.2/63371: 47% mana arcane_charge(4), rune_of_power
1:15.249 aoe n arcane_orb Fluffy_Pillow 33907.6/63371: 54% mana rune_of_power
1:16.555 aoe p arcane_barrage Fluffy_Pillow 35062.9/63371: 55% mana arcane_charge(4), rune_of_power
1:17.863 aoe o arcane_explosion Fluffy_Pillow 39255.5/63371: 62% mana rune_of_power
1:19.170 aoe o arcane_explosion Fluffy_Pillow 35912.1/63371: 57% mana arcane_charge, rune_of_power
1:20.478 aoe o arcane_explosion Fluffy_Pillow 32569.9/63371: 51% mana arcane_charge(2), rune_of_power
1:21.784 aoe o arcane_explosion Fluffy_Pillow 29225.1/63371: 46% mana arcane_charge(3), rune_of_power
1:23.089 aoe p arcane_barrage Fluffy_Pillow 25879.1/63371: 41% mana arcane_charge(4), clearcasting
1:24.396 aoe o arcane_explosion Fluffy_Pillow 30070.5/63371: 47% mana clearcasting
1:25.703 aoe o arcane_explosion Fluffy_Pillow 31727.0/63371: 50% mana arcane_charge
1:27.009 aoe o arcane_explosion Fluffy_Pillow 28382.3/63371: 45% mana arcane_charge(2)
1:28.316 aoe o arcane_explosion Fluffy_Pillow 25038.8/63371: 40% mana arcane_charge(3)
1:29.624 aoe p arcane_barrage Fluffy_Pillow 21696.6/63371: 34% mana arcane_charge(4)
1:30.930 aoe o arcane_explosion Fluffy_Pillow 25886.8/63371: 41% mana
1:32.236 aoe o arcane_explosion Fluffy_Pillow 22542.0/63371: 36% mana arcane_charge
1:33.543 aoe o arcane_explosion Fluffy_Pillow 19198.5/63371: 30% mana arcane_charge(2)
1:34.850 aoe o arcane_explosion Fluffy_Pillow 15855.1/63371: 25% mana arcane_charge(3)
1:36.157 aoe p arcane_barrage Fluffy_Pillow 12511.6/63371: 20% mana arcane_charge(4)
1:37.464 aoe n arcane_orb Fluffy_Pillow 16703.0/63371: 26% mana
1:38.770 aoe p arcane_barrage Fluffy_Pillow 17858.3/63371: 28% mana arcane_charge(4)
1:40.077 aoe o arcane_explosion Fluffy_Pillow 22049.6/63371: 35% mana
1:41.383 aoe o arcane_explosion Fluffy_Pillow 18704.9/63371: 30% mana arcane_charge, clearcasting
1:42.690 aoe o arcane_explosion Fluffy_Pillow 20361.4/63371: 32% mana arcane_charge(2)
1:43.997 aoe o arcane_explosion Fluffy_Pillow 17018.0/63371: 27% mana arcane_charge(3)
1:45.302 aoe p arcane_barrage Fluffy_Pillow 13672.0/63371: 22% mana arcane_charge(4)
1:46.610 aoe o arcane_explosion Fluffy_Pillow 17864.6/63371: 28% mana
1:47.917 aoe o arcane_explosion Fluffy_Pillow 14521.1/63371: 23% mana arcane_charge
1:49.222 aoe o arcane_explosion Fluffy_Pillow 11175.1/63371: 18% mana arcane_charge(2)
1:50.529 aoe o arcane_explosion Fluffy_Pillow 7831.7/63371: 12% mana arcane_charge(3)
1:51.836 aoe p arcane_barrage Fluffy_Pillow 4488.2/63371: 7% mana arcane_charge(4)
1:53.143 aoe k touch_of_the_magi Fluffy_Pillow 8679.6/63371: 14% mana
1:54.447 aoe m rune_of_power Fluffy_Pillow 7832.3/63371: 12% mana arcane_charge(4)
1:55.752 aoe p arcane_barrage Fluffy_Pillow 9486.3/63371: 15% mana arcane_charge(4), rune_of_power
1:57.059 aoe o arcane_explosion Fluffy_Pillow 13677.7/63371: 22% mana rune_of_power
1:58.364 aoe o arcane_explosion Fluffy_Pillow 10331.7/63371: 16% mana arcane_charge, rune_of_power
1:59.671 aoe o arcane_explosion Fluffy_Pillow 6988.2/63371: 11% mana arcane_charge(2), rune_of_power
2:00.976 aoe q evocation Venthyr 3642.2/63371: 6% mana arcane_charge(3), rune_of_power
2:05.321 aoe o arcane_explosion Fluffy_Pillow 57488.1/63371: 91% mana arcane_charge(3), rune_of_power
2:06.629 aoe p arcane_barrage Fluffy_Pillow 54145.9/63371: 85% mana arcane_charge(4), rune_of_power
2:07.936 aoe n arcane_orb Fluffy_Pillow 58337.3/63371: 92% mana rune_of_power
2:09.242 aoe p arcane_barrage Fluffy_Pillow 59492.6/63371: 94% mana arcane_charge(4), rune_of_power
2:10.547 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana rune_of_power
2:11.853 aoe o arcane_explosion Fluffy_Pillow 60026.7/63371: 95% mana arcane_charge
2:13.158 aoe o arcane_explosion Fluffy_Pillow 56680.7/63371: 89% mana arcane_charge(2), clearcasting
2:14.464 aoe o arcane_explosion Fluffy_Pillow 58335.9/63371: 92% mana arcane_charge(3)
2:15.771 aoe l arcane_power Fluffy_Pillow 54992.5/63371: 87% mana arcane_charge(4)
2:15.771 aoe p arcane_barrage Fluffy_Pillow 54992.5/63371: 87% mana arcane_charge(4), arcane_power, rune_of_power
2:17.079 aoe o arcane_explosion Fluffy_Pillow 59185.1/63371: 93% mana arcane_power, rune_of_power
2:18.386 aoe o arcane_explosion Fluffy_Pillow 58341.7/63371: 92% mana arcane_charge, arcane_power, rune_of_power
2:19.691 aoe o arcane_explosion Fluffy_Pillow 57495.7/63371: 91% mana arcane_charge(2), arcane_power, rune_of_power
2:20.998 aoe o arcane_explosion Fluffy_Pillow 56652.2/63371: 89% mana arcane_charge(3), arcane_power, rune_of_power
2:22.305 aoe p arcane_barrage Fluffy_Pillow 55808.7/63371: 88% mana arcane_charge(4), arcane_power, rune_of_power
2:23.612 aoe o arcane_explosion Fluffy_Pillow 60000.1/63371: 95% mana arcane_power, rune_of_power
2:24.919 aoe o arcane_explosion Fluffy_Pillow 59156.6/63371: 93% mana arcane_charge, arcane_power, rune_of_power
2:26.226 aoe o arcane_explosion Fluffy_Pillow 58313.2/63371: 92% mana arcane_charge(2), arcane_power, rune_of_power
2:27.531 aoe o arcane_explosion Fluffy_Pillow 57467.1/63371: 91% mana arcane_charge(3), arcane_power, rune_of_power
2:28.837 aoe p arcane_barrage Fluffy_Pillow 56622.4/63371: 89% mana arcane_charge(4), arcane_power, rune_of_power
2:30.144 aoe n arcane_orb Fluffy_Pillow 60813.8/63371: 96% mana arcane_power, rune_of_power
2:31.451 aoe p arcane_barrage Fluffy_Pillow 62220.3/63371: 98% mana arcane_charge(4)
2:32.757 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana
2:34.065 aoe o arcane_explosion Fluffy_Pillow 60029.2/63371: 95% mana arcane_charge, clearcasting
2:35.373 aoe o arcane_explosion Fluffy_Pillow 61687.0/63371: 97% mana arcane_charge(2)
2:36.680 aoe o arcane_explosion Fluffy_Pillow 58343.6/63371: 92% mana arcane_charge(3)
2:37.986 aoe p arcane_barrage Fluffy_Pillow 54998.8/63371: 87% mana arcane_charge(4)
2:39.292 aoe o arcane_explosion Fluffy_Pillow 59188.9/63371: 93% mana
2:40.599 aoe j mirrors_of_torment Fluffy_Pillow 55845.5/63371: 88% mana arcane_charge, clearcasting
2:41.906 aoe k touch_of_the_magi Fluffy_Pillow 55502.0/63371: 88% mana arcane_charge, clearcasting
2:43.212 aoe m rune_of_power Fluffy_Pillow 54657.3/63371: 86% mana arcane_charge(4), clearcasting
2:44.519 aoe p arcane_barrage Fluffy_Pillow 58848.6/63371: 93% mana arcane_charge(4), clearcasting, rune_of_power
2:45.826 aoe o arcane_explosion Fluffy_Pillow 63040.0/63371: 99% mana clearcasting, rune_of_power
2:47.133 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana arcane_charge, rune_of_power
2:48.441 aoe o arcane_explosion Fluffy_Pillow 60029.2/63371: 95% mana arcane_charge(2), rune_of_power
2:49.748 aoe o arcane_explosion Fluffy_Pillow 59220.6/63371: 93% mana arcane_charge(3), clearcasting, rune_of_power
2:51.055 aoe p arcane_barrage Fluffy_Pillow 60877.1/63371: 96% mana arcane_charge(4), rune_of_power
2:52.361 aoe n arcane_orb Fluffy_Pillow 63371.4/63371: 100% mana rune_of_power
2:53.667 aoe p arcane_barrage Fluffy_Pillow 63371.4/63371: 100% mana arcane_charge(4), rune_of_power
2:54.973 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana rune_of_power
2:56.279 aoe o arcane_explosion Fluffy_Pillow 62561.5/63371: 99% mana arcane_charge, rune_of_power
2:57.585 aoe o arcane_explosion Fluffy_Pillow 59216.8/63371: 93% mana arcane_charge(2), rune_of_power
2:58.892 aoe o arcane_explosion Fluffy_Pillow 55873.3/63371: 88% mana arcane_charge(3), clearcasting, rune_of_power
3:00.200 aoe p arcane_barrage Fluffy_Pillow 57531.1/63371: 91% mana arcane_charge(4)
3:01.504 aoe o arcane_explosion Fluffy_Pillow 61718.7/63371: 97% mana
3:02.810 aoe o arcane_explosion Fluffy_Pillow 58374.0/63371: 92% mana arcane_charge
3:04.116 aoe o arcane_explosion Fluffy_Pillow 55029.2/63371: 87% mana arcane_charge(2), clearcasting
3:05.423 aoe o arcane_explosion Fluffy_Pillow 56685.8/63371: 89% mana arcane_charge(3)
3:06.729 shared_cds r use_mana_gem Venthyr 53341.0/63371: 84% mana arcane_charge(4)
3:06.729 aoe p arcane_barrage Fluffy_Pillow 59678.2/63371: 94% mana arcane_charge(4)
3:08.036 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana
3:09.343 aoe o arcane_explosion Fluffy_Pillow 60028.0/63371: 95% mana arcane_charge
3:10.649 aoe o arcane_explosion Fluffy_Pillow 56683.2/63371: 89% mana arcane_charge(2)
3:11.955 aoe o arcane_explosion Fluffy_Pillow 53338.5/63371: 84% mana arcane_charge(3)
3:13.261 aoe p arcane_barrage Fluffy_Pillow 49993.7/63371: 79% mana arcane_charge(4)
3:14.567 aoe n arcane_orb Fluffy_Pillow 54183.9/63371: 86% mana
3:15.872 aoe p arcane_barrage Fluffy_Pillow 55337.9/63371: 87% mana arcane_charge(4)
3:17.179 aoe o arcane_explosion Fluffy_Pillow 59529.2/63371: 94% mana
3:18.487 aoe o arcane_explosion Fluffy_Pillow 56187.0/63371: 89% mana arcane_charge
3:19.794 aoe o arcane_explosion Fluffy_Pillow 52843.6/63371: 83% mana arcane_charge(2)
3:21.100 aoe o arcane_explosion Fluffy_Pillow 49498.8/63371: 78% mana arcane_charge(3), clearcasting
3:22.406 aoe p arcane_barrage Fluffy_Pillow 51154.1/63371: 81% mana arcane_charge(4)
3:23.712 aoe o arcane_explosion Fluffy_Pillow 55344.2/63371: 87% mana
3:25.019 aoe o arcane_explosion Fluffy_Pillow 52000.7/63371: 82% mana arcane_charge
3:26.328 aoe o arcane_explosion Fluffy_Pillow 48659.8/63371: 77% mana arcane_charge(2)
3:27.636 aoe o arcane_explosion Fluffy_Pillow 45317.6/63371: 72% mana arcane_charge(3)
3:28.944 aoe p arcane_barrage Fluffy_Pillow 41975.4/63371: 66% mana arcane_charge(4)
3:30.251 aoe k touch_of_the_magi Fluffy_Pillow 46166.8/63371: 73% mana
3:31.557 aoe m rune_of_power Fluffy_Pillow 45322.0/63371: 72% mana arcane_charge(4)
3:32.864 aoe p arcane_barrage Fluffy_Pillow 46978.6/63371: 74% mana arcane_charge(4), rune_of_power
3:34.171 aoe o arcane_explosion Fluffy_Pillow 51170.0/63371: 81% mana rune_of_power
3:35.477 aoe o arcane_explosion Fluffy_Pillow 47825.2/63371: 75% mana arcane_charge, rune_of_power
3:36.785 aoe o arcane_explosion Fluffy_Pillow 44483.0/63371: 70% mana arcane_charge(2), rune_of_power
3:38.091 aoe o arcane_explosion Fluffy_Pillow 41138.3/63371: 65% mana arcane_charge(3), rune_of_power
3:39.397 aoe p arcane_barrage Fluffy_Pillow 37793.5/63371: 60% mana arcane_charge(4), clearcasting, rune_of_power
3:40.702 aoe n arcane_orb Fluffy_Pillow 41982.4/63371: 66% mana clearcasting, rune_of_power
3:42.009 aoe p arcane_barrage Fluffy_Pillow 43138.9/63371: 68% mana arcane_charge(4), clearcasting, rune_of_power
3:43.315 aoe o arcane_explosion Fluffy_Pillow 47329.0/63371: 75% mana clearcasting, rune_of_power
3:44.622 aoe o arcane_explosion Fluffy_Pillow 48985.6/63371: 77% mana arcane_charge, rune_of_power
3:45.929 aoe o arcane_explosion Fluffy_Pillow 45642.1/63371: 72% mana arcane_charge(2), rune_of_power
3:47.235 aoe o arcane_explosion Fluffy_Pillow 42297.4/63371: 67% mana arcane_charge(3), rune_of_power
3:48.543 aoe p arcane_barrage Fluffy_Pillow 38955.2/63371: 61% mana arcane_charge(4)
3:49.849 aoe o arcane_explosion Fluffy_Pillow 43145.3/63371: 68% mana
3:51.155 aoe o arcane_explosion Fluffy_Pillow 39800.5/63371: 63% mana arcane_charge
3:52.462 aoe o arcane_explosion Fluffy_Pillow 36457.1/63371: 58% mana arcane_charge(2)
3:53.769 aoe o arcane_explosion Fluffy_Pillow 33113.6/63371: 52% mana arcane_charge(3)
3:55.076 aoe p arcane_barrage Fluffy_Pillow 29770.1/63371: 47% mana arcane_charge(4), clearcasting
3:56.383 aoe o arcane_explosion Fluffy_Pillow 33961.5/63371: 54% mana clearcasting
3:57.690 aoe o arcane_explosion Fluffy_Pillow 35618.0/63371: 56% mana arcane_charge
3:58.996 aoe o arcane_explosion Fluffy_Pillow 32273.3/63371: 51% mana arcane_charge(2)
4:00.303 aoe o arcane_explosion Fluffy_Pillow 28929.8/63371: 46% mana arcane_charge(3)
4:01.609 aoe p arcane_barrage Fluffy_Pillow 25585.1/63371: 40% mana arcane_charge(4)
4:02.918 aoe n arcane_orb Fluffy_Pillow 29779.0/63371: 47% mana
4:04.225 aoe p arcane_barrage Fluffy_Pillow 30935.5/63371: 49% mana arcane_charge(4)
4:05.532 aoe o arcane_explosion Fluffy_Pillow 35126.9/63371: 55% mana
4:06.838 aoe o arcane_explosion Fluffy_Pillow 31782.2/63371: 50% mana arcane_charge
4:08.143 aoe o arcane_explosion Fluffy_Pillow 28436.2/63371: 45% mana arcane_charge(2)
4:09.449 aoe o arcane_explosion Fluffy_Pillow 25091.4/63371: 40% mana arcane_charge(3)
4:10.756 aoe p arcane_barrage Fluffy_Pillow 21748.0/63371: 34% mana arcane_charge(4)
4:12.062 aoe o arcane_explosion Fluffy_Pillow 25938.1/63371: 41% mana
4:13.367 aoe o arcane_explosion Fluffy_Pillow 22592.1/63371: 36% mana arcane_charge
4:14.674 aoe o arcane_explosion Fluffy_Pillow 19248.6/63371: 30% mana arcane_charge(2)
4:15.981 aoe o arcane_explosion Fluffy_Pillow 15905.1/63371: 25% mana arcane_charge(3)
4:17.287 aoe p arcane_barrage Fluffy_Pillow 12560.4/63371: 20% mana arcane_charge(4)
4:18.594 aoe j mirrors_of_torment Fluffy_Pillow 16751.8/63371: 26% mana
4:19.901 aoe k touch_of_the_magi Fluffy_Pillow 16408.3/63371: 26% mana
4:21.207 aoe l arcane_power Fluffy_Pillow 15563.6/63371: 25% mana arcane_charge(4)
4:21.207 shared_cds t berserking Fluffy_Pillow 15563.6/63371: 25% mana arcane_charge(4), arcane_power, rune_of_power
4:21.207 aoe p arcane_barrage Fluffy_Pillow 15563.6/63371: 25% mana berserking, arcane_charge(4), arcane_power, rune_of_power
4:22.393 aoe o arcane_explosion Fluffy_Pillow 22136.5/63371: 35% mana berserking, arcane_power, rune_of_power
4:23.582 aoe o arcane_explosion Fluffy_Pillow 21143.4/63371: 33% mana berserking, arcane_charge, arcane_power, rune_of_power
4:24.771 aoe o arcane_explosion Fluffy_Pillow 20150.4/63371: 32% mana berserking, arcane_charge(2), arcane_power, rune_of_power
4:25.960 aoe o arcane_explosion Fluffy_Pillow 19157.4/63371: 30% mana berserking, arcane_charge(3), arcane_power, rune_of_power
4:27.150 aoe p arcane_barrage Fluffy_Pillow 18165.6/63371: 29% mana berserking, arcane_charge(4), arcane_power, rune_of_power
4:28.340 aoe n arcane_orb Fluffy_Pillow 24743.6/63371: 39% mana berserking, arcane_power, rune_of_power
4:29.530 aoe p arcane_barrage Fluffy_Pillow 26001.8/63371: 41% mana berserking, arcane_charge(4), arcane_power, rune_of_power
4:30.719 aoe o arcane_explosion Fluffy_Pillow 30043.7/63371: 47% mana berserking, arcane_power, rune_of_power
4:31.906 aoe o arcane_explosion Fluffy_Pillow 29048.1/63371: 46% mana berserking, arcane_charge, arcane_power, rune_of_power
4:33.094 aoe o arcane_explosion Fluffy_Pillow 28053.8/63371: 44% mana berserking, arcane_charge(2), arcane_power, rune_of_power
4:34.282 aoe o arcane_explosion Fluffy_Pillow 29594.4/63371: 47% mana arcane_charge(3), arcane_power, rune_of_power
4:35.589 aoe p arcane_barrage Fluffy_Pillow 28750.9/63371: 45% mana arcane_charge(4), arcane_power, rune_of_power
4:36.896 aoe o arcane_explosion Fluffy_Pillow 32942.3/63371: 52% mana
4:38.202 aoe o arcane_explosion Fluffy_Pillow 29597.5/63371: 47% mana arcane_charge
4:39.508 aoe o arcane_explosion Fluffy_Pillow 26252.8/63371: 41% mana arcane_charge(2)
4:40.817 aoe o arcane_explosion Fluffy_Pillow 22911.9/63371: 36% mana arcane_charge(3)
4:42.124 aoe m rune_of_power Fluffy_Pillow 19568.4/63371: 31% mana arcane_charge(4)
4:43.430 aoe p arcane_barrage Fluffy_Pillow 21223.7/63371: 33% mana arcane_charge(4), rune_of_power
4:44.734 aoe o arcane_explosion Fluffy_Pillow 25411.2/63371: 40% mana rune_of_power
4:46.040 aoe o arcane_explosion Fluffy_Pillow 22066.5/63371: 35% mana arcane_charge, rune_of_power
4:47.347 aoe o arcane_explosion Fluffy_Pillow 18723.0/63371: 30% mana arcane_charge(2), clearcasting, rune_of_power
4:48.652 aoe o arcane_explosion Fluffy_Pillow 20377.0/63371: 32% mana arcane_charge(3), rune_of_power
4:49.959 aoe p arcane_barrage Fluffy_Pillow 17033.6/63371: 27% mana arcane_charge(4), rune_of_power
4:51.265 aoe n arcane_orb Fluffy_Pillow 21223.7/63371: 33% mana rune_of_power
4:52.572 aoe p arcane_barrage Fluffy_Pillow 22380.2/63371: 35% mana arcane_charge(4), rune_of_power
4:53.877 aoe o arcane_explosion Fluffy_Pillow 26569.1/63371: 42% mana rune_of_power
4:55.182 aoe o arcane_explosion Fluffy_Pillow 23223.0/63371: 37% mana arcane_charge, rune_of_power
4:56.488 aoe o arcane_explosion Fluffy_Pillow 19878.3/63371: 31% mana arcane_charge(2), rune_of_power
4:57.795 aoe o arcane_explosion Fluffy_Pillow 16534.8/63371: 26% mana arcane_charge(3), clearcasting, rune_of_power
4:59.101 aoe p arcane_barrage Fluffy_Pillow 18190.1/63371: 29% mana arcane_charge(4)
5:00.408 aoe o arcane_explosion Fluffy_Pillow 22381.5/63371: 35% mana
5:01.715 aoe o arcane_explosion Fluffy_Pillow 19038.0/63371: 30% mana arcane_charge
5:03.023 aoe o arcane_explosion Fluffy_Pillow 15695.8/63371: 25% mana arcane_charge(2), clearcasting
5:04.328 aoe o arcane_explosion Fluffy_Pillow 17349.8/63371: 27% mana arcane_charge(3)
5:05.635 aoe p arcane_barrage Fluffy_Pillow 14006.3/63371: 22% mana arcane_charge(4)
5:06.940 shared_cds r use_mana_gem Venthyr 18195.2/63371: 29% mana
5:06.940 aoe o arcane_explosion Fluffy_Pillow 24532.3/63371: 39% mana
5:08.248 aoe o arcane_explosion Fluffy_Pillow 21190.1/63371: 33% mana arcane_charge
5:09.554 aoe o arcane_explosion Fluffy_Pillow 17845.4/63371: 28% mana arcane_charge(2), clearcasting
5:10.860 aoe o arcane_explosion Fluffy_Pillow 19500.6/63371: 31% mana arcane_charge(3)
5:12.165 aoe p arcane_barrage Fluffy_Pillow 16154.6/63371: 25% mana arcane_charge(4)
5:13.473 aoe n arcane_orb Fluffy_Pillow 20347.3/63371: 32% mana
5:14.779 aoe p arcane_barrage Fluffy_Pillow 21502.6/63371: 34% mana arcane_charge(4)
5:16.087 aoe o arcane_explosion Fluffy_Pillow 25695.2/63371: 41% mana
5:17.396 aoe o arcane_explosion Fluffy_Pillow 22354.3/63371: 35% mana arcane_charge, clearcasting
5:18.703 aoe o arcane_explosion Fluffy_Pillow 24010.8/63371: 38% mana arcane_charge(2)
5:20.011 aoe o arcane_explosion Fluffy_Pillow 20668.6/63371: 33% mana arcane_charge(3)
5:21.318 aoe p arcane_barrage Fluffy_Pillow 17325.1/63371: 27% mana arcane_charge(4), clearcasting
5:22.625 aoe o arcane_explosion Fluffy_Pillow 21516.5/63371: 34% mana clearcasting
5:23.933 aoe o arcane_explosion Fluffy_Pillow 23174.3/63371: 37% mana arcane_charge
5:25.239 aoe o arcane_explosion Fluffy_Pillow 19829.6/63371: 31% mana arcane_charge(2), clearcasting
5:26.545 aoe o arcane_explosion Fluffy_Pillow 21484.8/63371: 34% mana arcane_charge(3)
5:27.850 aoe p arcane_barrage Fluffy_Pillow 18138.8/63371: 29% mana arcane_charge(4)
5:29.158 aoe k touch_of_the_magi Fluffy_Pillow 22331.5/63371: 35% mana
5:30.465 aoe m rune_of_power Fluffy_Pillow 21488.0/63371: 34% mana arcane_charge(4)
5:31.772 aoe p arcane_barrage Fluffy_Pillow 23144.5/63371: 37% mana arcane_charge(4), rune_of_power
5:33.079 aoe o arcane_explosion Fluffy_Pillow 27335.9/63371: 43% mana rune_of_power

Stats

Level Bonus (60) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 198 1 199 199 0
Agility 306 2 308 308 0
Stamina 414 0 434 414 0
Intellect 450 -3 2453 2247 1800
Spirit 0 0 0 0 0
Health 8680 8280 0
Mana 63371 63371 0
Spell Power 2453 2247 0
Crit 19.29% 19.29% 500
Haste 15.15% 15.15% 500
Versatility 12.50% 12.50% 500
Mana Regen 1267 1267 0
Mastery 26.74% 26.74% 500
Armor 0 0 0
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 0.00

Profile

mage="Venthyr"
source=default
spec=arcane
level=60
race=troll
role=spell
position=back
talents=1032021
covenant=venthyr

# Default consumables
potion=deathly_fixation
flask=spectral_flask_of_power
food=feast_of_gluttonous_hedonism
augmentation=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=variable,name=prepull_evo,op=reset,default=0
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
actions.precombat+=/variable,name=have_opened,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
actions.precombat+=/variable,name=final_burn,op=set,value=0
actions.precombat+=/variable,name=rs_max_delay,op=reset,default=5
actions.precombat+=/variable,name=ap_max_delay,op=reset,default=10
actions.precombat+=/variable,name=rop_max_delay,op=reset,default=20
actions.precombat+=/variable,name=totm_max_delay,op=reset,default=5
actions.precombat+=/variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
actions.precombat+=/variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
actions.precombat+=/variable,name=barrage_mana_pct,op=reset,default=70
actions.precombat+=/variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=reset,default=30
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
actions.precombat+=/variable,name=totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=aoe_totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=am_spam,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
actions.precombat+=/variable,name=am_spam_evo_pct,op=reset,default=15
actions.precombat+=/flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/arcane_familiar
actions.precombat+=/arcane_intellect
actions.precombat+=/conjure_mana_gem
actions.precombat+=/snapshot_stats
actions.precombat+=/mirror_image
actions.precombat+=/frostbolt,if=variable.prepull_evo<=0
actions.precombat+=/evocation,if=variable.prepull_evo>0

# Executed every time the actor is available.
actions=counterspell,if=target.debuff.casting.react
actions+=/call_action_list,name=shared_cds
actions+=/call_action_list,name=essences
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/call_action_list,name=opener,if=variable.have_opened<=0
actions+=/call_action_list,name=am_spam,if=variable.am_spam=1
actions+=/call_action_list,name=cooldowns
actions+=/call_action_list,name=rotation,if=variable.final_burn=0
actions+=/call_action_list,name=final_burn,if=variable.final_burn=1
actions+=/call_action_list,name=movement

actions.am_spam=cancel_action,if=action.evocation.channeling&mana.pct>=95
actions.am_spam+=/evocation,if=mana.pct<=variable.am_spam_evo_pct&(cooldown.touch_of_the_magi.remains<=action.evocation.execute_time|cooldown.arcane_power.remains<=action.evocation.execute_time|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=action.evocation.execute_time))&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/rune_of_power,if=buff.rune_of_power.down&cooldown.arcane_power.remains>0
actions.am_spam+=/touch_of_the_magi,if=(cooldown.arcane_power.remains=0&buff.rune_of_power.down)|prev_gcd.1.rune_of_power
actions.am_spam+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&buff.rune_of_power.down&essence.vision_of_perfection.enabled
actions.am_spam+=/arcane_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.ap_max_delay
actions.am_spam+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=action.arcane_missiles.execute_time&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_barrage,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_missiles,if=buff.clearcasting.react,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/arcane_missiles,if=!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/evocation,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.am_spam+=/arcane_barrage
actions.am_spam+=/arcane_blast

actions.aoe=frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
actions.aoe+=/arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
actions.aoe+=/mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
actions.aoe+=/arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
actions.aoe+=/rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
actions.aoe+=/presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
actions.aoe+=/arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
actions.aoe+=/supernova
actions.aoe+=/arcane_orb,if=buff.arcane_charge.stack=0
actions.aoe+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
actions.aoe+=/arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1

# Prioritize using grisly icicle with ap. Use it with totm otherwise.
actions.cooldowns=frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.cooldowns+=/frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/fire_blast,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt
# Always use mirrors with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/mirrors_of_torment,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/mirrors_of_torment,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Always use deathborne with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/deathborne,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/deathborne,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use spark if totm and ap are on cd and won't be up for longer than the max delay, making sure we have at least two arcane charges and that totm wasn't just used.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack>2&debuff.touch_of_the_magi.down
# Use spark with ap when possible. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/radiant_spark,if=cooldown.arcane_power.remains=0&((!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct)
actions.cooldowns+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&essence.vision_of_perfection.minor
# Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken. Hold a bit to make sure we can RS immediately after totm ends
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8
# Non-Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken.
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
# Use ap if totm is on cd and won't be up for longer than the max delay, making sure that we have enough mana and that there is not already a rune of power down.
actions.cooldowns+=/arcane_power,if=(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use rop if totm is on cd and won't be up for longer than the max delay, making sure there isn't already a rune down and that ap won't become available during rune.
actions.cooldowns+=/rune_of_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.rop_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
# Kyrian: RS is mana hungry and AB4s are too expensive to use pom to squeeze an extra ab in the totm window. Let's use it to make low charge ABs instant.
actions.cooldowns+=/presence_of_mind,if=buff.arcane_charge.stack=0&covenant.kyrian.enabled
# Non-Kyrian: Use pom to squeeze an extra ab in the totm window.
actions.cooldowns+=/presence_of_mind,if=debuff.touch_of_the_magi.up&!covenant.kyrian.enabled

actions.essences=blood_of_the_enemy,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/blood_of_the_enemy,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains>=50&cooldown.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay
actions.essences+=/worldvein_resonance,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/guardian_of_azeroth,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/guardian_of_azeroth,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/concentrated_flame,line_cd=6,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/reaping_flames,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/focused_azerite_beam,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/purifying_blast,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/ripple_in_space,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/the_unbound_force,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/memory_of_lucid_dreams,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down

actions.final_burn=arcane_missiles,if=buff.clearcasting.react,chain=1
actions.final_burn+=/arcane_blast
actions.final_burn+=/arcane_barrage

actions.movement=blink_any,if=movement.distance>=10
actions.movement+=/presence_of_mind
actions.movement+=/arcane_missiles,if=movement.distance<10
actions.movement+=/arcane_orb
actions.movement+=/fire_blast

actions.opener=variable,name=have_opened,op=set,value=1,if=prev_gcd.1.evocation
actions.opener+=/fire_blast,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command_frost.up
actions.opener+=/frost_nova,if=runeforge.grisly_icicle.equipped&mana.pct>95
actions.opener+=/mirrors_of_torment
actions.opener+=/deathborne
actions.opener+=/radiant_spark,if=mana.pct>40
actions.opener+=/cancel_action,if=action.shifting_power.channeling&gcd.remains=0
actions.opener+=/shifting_power,if=soulbind.field_of_blossoms.enabled
actions.opener+=/touch_of_the_magi
actions.opener+=/arcane_power
actions.opener+=/rune_of_power,if=buff.rune_of_power.down
actions.opener+=/presence_of_mind
actions.opener+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.opener+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.opener+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.opener+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.opener+=/arcane_missiles,if=buff.clearcasting.react,chain=1
actions.opener+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges&(cooldown.arcane_power.remains>10|active_enemies<=2)
actions.opener+=/arcane_blast,if=buff.rune_of_power.up|mana.pct>15
actions.opener+=/evocation,if=buff.rune_of_power.down,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.opener+=/arcane_barrage

actions.rotation=variable,name=final_burn,op=set,value=1,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&!buff.rule_of_threes.up&fight_remains<=((mana%action.arcane_blast.cost)*action.arcane_blast.execute_time)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&cooldown.arcane_power.remains<=gcd)
actions.rotation+=/strict_sequence,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&buff.arcane_power.down&buff.rune_of_power.down,name=last_spark_stack:arcane_blast:arcane_barrage
actions.rotation+=/arcane_barrage,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&(buff.arcane_power.down|buff.arcane_power.remains<=gcd)&(buff.rune_of_power.down|buff.rune_of_power.remains<=gcd)
actions.rotation+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.rotation+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.rotation+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&(debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time|cooldown.presence_of_mind.remains>0|covenant.kyrian.enabled)&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.expanded_potential.up
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&(buff.arcane_power.up|buff.rune_of_power.up|debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.stack=buff.clearcasting.max_stack,chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.remains<=((buff.clearcasting.stack*action.arcane_missiles.execute_time)+gcd),chain=1
actions.rotation+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges
actions.rotation+=/supernova,if=mana.pct<=95&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.evocation.remains>0&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.rotation+=/arcane_blast,if=buff.rule_of_threes.up&buff.arcane_charge.stack>3
actions.rotation+=/arcane_barrage,if=mana.pct<variable.barrage_mana_pct&cooldown.evocation.remains>0&buff.arcane_power.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&essence.vision_of_perfection.minor
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(cooldown.rune_of_power.remains=0|cooldown.arcane_power.remains=0)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=mana.pct<=variable.barrage_mana_pct&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&talent.arcane_orb.enabled&cooldown.arcane_orb.remains<=gcd&mana.pct<=90&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.rune_of_power.up&buff.rune_of_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_blast
actions.rotation+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.rotation+=/arcane_barrage

actions.shared_cds=use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
actions.shared_cds+=/use_items,if=buff.arcane_power.up
actions.shared_cds+=/potion,if=buff.arcane_power.up
actions.shared_cds+=/time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
actions.shared_cds+=/lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/berserking,if=buff.arcane_power.up
actions.shared_cds+=/blood_fury,if=buff.arcane_power.up
actions.shared_cds+=/fireblood,if=buff.arcane_power.up
actions.shared_cds+=/ancestral_call,if=buff.arcane_power.up


# Gear Summary
# gear_ilvl=0.00
# gear_intellect=1800
# gear_crit_rating=500
# gear_haste_rating=500
# gear_mastery_rating=500
# gear_versatility_rating=500

arcane : 10912 dps, 4600 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
10911.7 10911.7 19.9 / 0.182% 1104.0 / 10.1% 5.3
RPS Out RPS In Primary Resource Waiting APM Active Skill
2049.6 1947.1 Mana 0.00% 49.4 100.0% 100%
Talents

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
arcane 10912
Arcane Barrage 4026 36.9% 57.5 5.26sec 21120 16993 Direct 172.3 5902 11851 7050 19.3%

Stats Details: Arcane Barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 57.52 172.35 0.00 0.00 1.2428 0.0000 1214771.62 1214771.62 0.00% 16993.38 16993.38
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.69% 139.06 103 176 5902.22 2082 25140 5890.94 5125 6619 820411 820411 0.00%
crit 19.31% 33.29 14 53 11851.21 4164 50280 11840.47 7808 16376 394360 394360 0.00%

Action Details: Arcane Barrage

  • id:44425
  • school:arcane
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:3.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.728000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:44425
  • name:Arcane Barrage
  • school:arcane
  • tooltip:
  • description:Launches bolts of arcane energy at the enemy target, causing {$s1=0 + 72.8%} Arcane damage. For each Arcane Charge, deals {$36032s2=30}% additional damage$?a321526[, grants you {$321526s1=2}% of your maximum mana,][]$?a231564[ and hits {$36032s3=0} additional nearby $Ltarget:targets; for {$s2=40}% of its damage][]. |cFFFFFFFFConsumes all Arcane Charges.|r

Action Priority List

    aoe
    [o]:57.51
  • if_expr:buff.arcane_charge.stack=buff.arcane_charge.max_stack
    rotation
    [q]:0.00
Arcane Echo 234 2.1% 37.0 7.61sec 1904 0 Direct 111.0 532 1063 635 19.4%

Stats Details: Arcane Echo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 37.01 111.04 0.00 0.00 0.0000 0.0000 70486.85 70486.85 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.64% 89.55 56 118 532.12 443 664 531.65 497 559 47638 47638 0.00%
crit 19.36% 21.50 6 35 1063.28 886 1329 1061.72 908 1240 22849 22849 0.00%

Action Details: Arcane Echo

  • id:342232
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.109200
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:342232
  • name:Arcane Echo
  • school:arcane
  • tooltip:
  • description:{$@spelldesc342231=Direct damage you deal to enemies affected by Touch of the Magi, causes an explosion that deals {$342232s1=0 + 10.9%} Arcane damage to {$s1=8} nearby enemies.}
Arcane Explosion 5161 47.3% 155.6 1.91sec 9990 8038 Direct 466.8 2788 5587 3331 19.4%

Stats Details: Arcane Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 155.60 466.81 0.00 0.00 1.2429 0.0000 1554486.03 1554486.03 0.00% 8037.96 8037.96
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.62% 376.34 284 462 2788.43 2128 4469 2788.64 2692 2880 1049158 1049158 0.00%
crit 19.38% 90.47 54 128 5586.90 4256 8938 5587.58 5095 6193 505328 505328 0.00%

Action Details: Arcane Explosion

  • id:1449
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:5000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.546000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:1449
  • name:Arcane Explosion
  • school:arcane
  • tooltip:
  • description:Causes an explosion of magic around the caster, dealing {$s2=0 + 54.6%} Arcane damage to all enemies within $A2 yards.$?a137021[ |cFFFFFFFFGenerates {$s1=1} Arcane Charge if any targets are hit.|r][]

Action Priority List

    aoe
    [n]:155.60
  • if_expr:buff.arcane_charge.stack<buff.arcane_charge.max_stack
Arcane Orb 0 (856) 0.0% (7.8%) 13.2 23.63sec 19584 15705

Stats Details: Arcane Orb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 13.17 0.00 0.00 0.00 1.2471 0.0000 0.00 0.00 0.00% 15705.16 15705.16

Action Details: Arcane Orb

  • id:153626
  • school:arcane
  • range:40.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Spelldata

  • id:153626
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r

Action Priority List

    aoe
    [m]:13.16
  • if_expr:buff.arcane_charge.stack=0
    Arcane Orb (_bolt) 856 7.8% 39.5 23.62sec 6534 0 Direct 39.5 5459 10920 6535 19.7%

Stats Details: Arcane Orb Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 39.46 39.46 0.00 0.00 0.0000 0.0000 257863.02 257863.02 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.30% 31.69 20 44 5459.43 3869 8126 5457.46 4947 6057 172916 172916 0.00%
crit 19.70% 7.78 2 16 10919.74 7739 16251 10927.24 7739 14897 84947 84947 0.00%

Action Details: Arcane Orb Bolt

  • id:153640
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.092000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:153640
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:{$@spelldesc153626=Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r}
Deathly Fixation 0 (67) 0.0% (0.6%) 14.5 1.75sec 1385 0

Stats Details: Deathly Fixation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.47 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Deathly Fixation

  • id:322253
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:42.90
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:322253
  • name:Deathly Fixation
  • school:shadow
  • tooltip:Taking $w1 Shadow damage every $t1.
  • description:Deal {$s1=43} Shadow damage every $t1. Stacks up to 5 times.
    Deathly Eruption 67 0.6% 14.5 1.75sec 1385 0 Direct 14.5 1164 2327 1385 19.0%

Stats Details: Deathly Eruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.47 14.47 0.00 0.00 0.0000 0.0000 20033.71 20033.71 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.98% 11.71 5 20 1163.53 1164 1164 1163.53 1164 1164 13631 13631 0.00%
crit 19.02% 2.75 0 8 2327.06 2327 2327 2188.18 0 2327 6403 6403 0.00%

Action Details: Deathly Eruption

  • id:322256
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:984.99
  • base_dd_max:984.99
  • base_dd_mult:1.00

Spelldata

  • id:322256
  • name:Deathly Eruption
  • school:shadow
  • tooltip:
  • description:Deal {$s1=985} Shadow damage.
Frostbolt 6 0.1% 0.0 0.00sec 0 0 Direct 1.0 1481 2961 1804 22.0%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 1.00 0.00 0.00 0.0000 0.0000 1807.11 1807.11 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.95% 0.78 0 1 1480.68 1481 1481 1154.24 0 1481 1154 1154 0.00%
crit 22.05% 0.22 0 1 2961.35 2961 2961 652.87 0 2961 653 653 0.00%

Action Details: Frostbolt

  • id:116
  • school:frost
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.511000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116
  • name:Frostbolt
  • school:frost
  • tooltip:
  • description:Launches a bolt of frost at the enemy, causing {$228597s1=0} Frost damage and slowing movement speed by {$205708s1=50}% for {$205708d=8 seconds}.
Mirror Image 0 (20) 0.0% (0.2%) 1.0 0.00sec 6039 0

Stats Details: Mirror Image

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Mirror Image

  • id:55342
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:55342
  • name:Mirror Image
  • school:arcane
  • tooltip:Damage taken is reduced by {$s3=20}% while your images are active.
  • description:Creates {$s2=3} copies of you nearby for {$55342d=40 seconds}, which cast spells and attack your enemies. While your images are active damage taken is reduced by {$s3=20}%, taking direct damage will cause one of your images to dissipate.
    Frostbolt (mirror_image) 151  / 20 0.2% 90.0 1.29sec 67 51 Direct 90.0 56 112 67 19.3%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 90.00 90.00 0.00 0.00 1.3087 0.0000 6039.33 6039.33 0.00% 51.28 51.28
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.65% 72.59 62 83 56.23 43 60 56.22 55 57 4081 4081 0.00%
crit 19.35% 17.41 7 28 112.45 86 120 112.41 102 120 1958 1958 0.00%

Action Details: Frostbolt

  • id:59638
  • school:frost
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.027000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:59638
  • name:Frostbolt
  • school:frost
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for {$d=4 seconds}.

Action Priority List

    default
    [ ]:31.00
Touch of the Magi 0 (541) 0.0% (5.0%) 6.2 52.41sec 26451 20246

Stats Details: Touch Of The Magi

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.15 0.00 0.00 0.00 1.3065 0.0000 0.00 0.00 0.00% 20246.18 20246.18

Action Details: Touch Of The Magi

  • id:321507
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:4.0

Spelldata

  • id:321507
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]

Action Priority List

    aoe
    [j]:6.16
  • if_expr:buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
    Touch of the Magi (_explosion) 541 5.0% 6.2 52.34sec 26451 0 Direct 18.4 8843 0 8843 0.0%

Stats Details: Touch Of The Magi Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.15 18.42 0.00 0.00 0.0000 0.0000 162799.49 162799.49 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 18.42 15 21 8843.47 2104 37235 8826.95 6108 11786 162799 162799 0.00%

Action Details: Touch Of The Magi Explosion

  • id:210833
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:9212.80
  • base_dd_max:9212.80
  • base_dd_mult:1.00

Spelldata

  • id:210833
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:{$@spelldesc321507=Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]}
Simple Action Stats Execute Interval
arcane
Arcane Power 2.9 128.51sec

Stats Details: Arcane Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.86 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Arcane Power

  • id:12042
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:12042
  • name:Arcane Power
  • school:arcane
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].

Action Priority List

    aoe
    [k]:2.87
  • if_expr:((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
Berserking 1.9 256.94sec

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.86 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    shared_cds
    [t]:1.87
  • if_expr:buff.arcane_power.up
Conjure Mana Gem 1.0 0.00sec

Stats Details: Conjure Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Conjure Mana Gem

  • id:759
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:9000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:759
  • name:Conjure Mana Gem
  • school:arcane
  • tooltip:
  • description:Conjures a Mana Gem that can be used to instantly restore {$5405s1=10}% mana, and holds up to {$s2=3} charges. $@spellname118812 {$@spelldesc118812=Conjured items disappear if logged out for more than 15 minutes.}
Evocation 1.2 169.99sec

Stats Details: Evocation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.20 0.00 7.16 0.00 4.3144 0.7223 0.00 0.00 0.00% 0.00 0.00

Action Details: Evocation

  • id:12051
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:arcane
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:12051
  • name:Evocation
  • school:arcane
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.

Action Priority List

    aoe
    [p]:1.20
  • interrupt_if_expr:mana.pct>=85
Spectral Flask of Power (flask) 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:307185
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:arcane
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of Gluttonous Hedonism (food) 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:308462
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:arcane
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Potion of Deathly Fixation (potion) 1.0 0.00sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:307497
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    shared_cds
    [s]:1.00
  • if_expr:buff.arcane_power.up
Rune of Power 5.9 51.45sec

Stats Details: Rune Of Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.95 0.00 0.00 0.00 1.2561 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Rune Of Power

  • id:116011
  • school:arcane
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:116011
  • name:Rune of Power
  • school:arcane
  • tooltip:
  • description:Places a Rune of Power on the ground for {$116011d=15 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.

Action Priority List

    aoe
    [l]:5.96
  • if_expr:buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
Replenish Mana (use_mana_gem) 2.8 123.43sec

Stats Details: Use Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.77 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Use Mana Gem

  • id:5405
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:arcane
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5405
  • name:Replenish Mana
  • school:physical
  • tooltip:Restoring $w2 mana every $t1 sec.
  • description:Restores {$s1=10}% mana.

Action Priority List

    shared_cds
    [r]:2.78
  • if_expr:(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Arcane Charge 58.3 156.1 5.2sec 1.4sec 3.8sec 74.00% 0.00% 0.8 (0.9) 0.0

Buff Details

  • buff initial source:arcane
  • cooldown name:buff_arcane_charge
  • max_stacks:4
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 12.3s
  • trigger_min/max:0.0s / 7.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 9.6s

Stack Uptimes

  • arcane_charge_1:19.09%
  • arcane_charge_2:16.48%
  • arcane_charge_3:16.87%
  • arcane_charge_4:21.56%

Spelldata

  • id:36032
  • name:Arcane Charge
  • tooltip:Increases the damage of Arcane Blast, Arcane Missiles, Arcane Explosion, and Arcane Barrage by $36032w1%. Increases the mana cost of Arcane Blast by $36032w2%$?{$w5<0}[, and reduces the cast time of Arcane Blast by $w5%.][.] Increases the number of targets hit by Arcane Barrage for 50% damage by $36032w3.
  • description:$@spelldesc114664
  • max_stacks:4
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Arcane Power 2.9 0.0 128.5sec 128.5sec 14.7sec 13.97% 0.00% 0.0 (0.0) 2.7

Buff Details

  • buff initial source:arcane
  • cooldown name:buff_arcane_power
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:120.8s / 133.2s
  • trigger_min/max:120.8s / 133.2s
  • trigger_pct:100.00%
  • duration_min/max:0.6s / 15.0s

Stack Uptimes

  • arcane_power_1:13.97%

Spelldata

  • id:12042
  • name:Arcane Power
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
Berserking 1.9 0.0 256.8sec 256.8sec 11.7sec 7.20% 23.86% 0.0 (0.0) 1.8

Buff Details

  • buff initial source:arcane
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:253.9s / 265.6s
  • trigger_min/max:253.9s / 265.6s
  • trigger_pct:100.00%
  • duration_min/max:0.6s / 12.0s

Stack Uptimes

  • berserking_1:7.20%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.45% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:arcane
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.45%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Clearcasting 24.6 0.1 11.9sec 11.8sec 2.0sec 15.96% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:arcane
  • cooldown name:buff_clearcasting
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stack Uptimes

  • clearcasting_1:15.86%
  • clearcasting_2:0.13%

Spelldata

  • id:263725
  • name:Clearcasting
  • tooltip:Your next Arcane Missiles or Arcane Explosion costs no mana{$?s321758=false}[ and Arcane Missiles fires an additional missile][].
  • description:{$@spelldesc79684=For each ${$c*100/{$s1=200}} mana you spend, you have a 1% chance to gain Clearcasting, making your next Arcane Missiles or Arcane Explosion free and channel {$277726s1=20}% faster.$?a321758[ Arcane Missiles fires {$321758s2=1} additional missile.][]}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Evocation 1.2 0.0 173.3sec 173.3sec 4.3sec 1.72% 0.00% 4.8 (4.8) 0.0

Buff Details

  • buff initial source:arcane
  • cooldown name:buff_evocation
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:7.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:1.00

Trigger Details

  • interval_min/max:99.7s / 263.1s
  • trigger_min/max:99.7s / 263.1s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 4.3s

Stack Uptimes

  • evocation_1:1.72%

Spelldata

  • id:12051
  • name:Evocation
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Deathly Fixation 1.0 0.0 0.0sec 0.0sec 25.0sec 8.40% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:arcane
  • cooldown name:buff_potion_of_deathly_fixation
  • max_stacks:1
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:25.0s / 25.0s

Stack Uptimes

  • potion_of_deathly_fixation_1:8.40%

Spelldata

  • id:307497
  • name:Potion of Deathly Fixation
  • tooltip:Chance to apply Deathly Fixation to your target.
  • description:Your damaging spells and abilities have a chance to apply Deathly Fixation to your target, dealing {$322253s1=43} Shadow damage over {$322253d=8 seconds} and stacking up to 5 times. Upon reaching 5 stacks, Deathly Fixation explodes, dealing {$322256s1=985} Shadow damage to the target. If you consume this potion while your weapon is augmented with Shadowcore Oil, the explosion damage is increased by {$s2=10}%. Lasts {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Rune of Power 8.8 0.0 35.7sec 35.7sec 14.7sec 42.94% 0.00% 0.0 (0.0) 8.4

Buff Details

  • buff initial source:arcane
  • cooldown name:buff_rune_of_power
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.40
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:15.7s / 52.7s
  • trigger_min/max:15.7s / 52.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • rune_of_power_1:42.94%

Spelldata

  • id:116014
  • name:Rune of Power
  • tooltip:Spell damage increased by $w1%.$?$w2=0[][ Health restored by $w2% per second.]
  • description:{$@spelldesc116011=Places a Rune of Power on the ground for {$116011d=15 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Well Fed (feast_of_gluttonous_hedonism)

Buff Details

  • buff initial source:arcane
  • cooldown name:buff_feast_of_gluttonous_hedonism
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327708
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=20}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Spectral Flask of Power

Buff Details

  • buff initial source:arcane
  • cooldown name:buff_spectral_flask_of_power
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:307185
  • name:Spectral Flask of Power
  • tooltip:$pri increased by $w1.
  • description:Increases $pri by {$s1=70} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs, Uptimes & Benefits

Benefit Avg % Min Max
Arcane Barrage Arcane Charge 3 0.00% 0.00% 1.79%
Arcane Barrage Arcane Charge 4 100.00% 98.21% 100.00%
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 2.10% 0.77% 7.62% 0.9s 0.0s 4.7s
Conserve Phase 100.00% 100.00% 100.00% 301.4s 240.2s 359.7s

Cooldown waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Mirror Image0.0000.0000.000181.465120.158239.654
Evocation139.3979.738320.847210.712138.536332.507
Rune of Power6.8750.01327.31043.46723.99658.631
Touch of the Magi5.1400.00027.30534.11922.39057.025
Arcane Power5.9690.76513.20117.2839.22126.855
Arcane Barrage2.7470.0008.281159.099126.347191.886
Arcane Orb3.5240.00010.48946.71433.73361.172

Burn Phases

Burn phase duration tracks the amount of time spent in each burn phase. This is defined as the time between a start_burn_phase and stop_burn_phase action being executed. Note that "execute" burn phases, i.e., the final burn of a fight, is also included.

Burn Phase Duration
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Mana at burn start is the mana level recorded (in percentage of total mana) when a start_burn_phase command is executed.

Mana at Burn Start
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
arcane
mana_regen Mana 492.04 371641.60 63.32% 755.30 9707.51 2.55%
Evocation Mana 57.41 57707.87 9.83% 1005.21 0.00 0.00%
Mana Gem Mana 2.78 17595.60 3.00% 6337.14 0.00 0.00%
Arcane Barrage Mana 57.51 139986.90 23.85% 2434.18 5788.59 3.97%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 62371.4 1947.14 2049.60 15478.6 32484.0 674.9 63371.4
Usage Type Count Total Avg RPE APR
arcane
arcane_explosion Mana 155.6 595606.3 3827.8 3827.8 2.6
arcane_orb Mana 13.2 5874.0 446.2 446.1 43.9
touch_of_the_magi Mana 6.2 15379.3 2500.0 2498.8 10.6

Statistics & Data Analysis

Fight Length
arcane Fight Length
Count 821
Mean 301.46
Minimum 240.16
Maximum 359.65
Spread ( max - min ) 119.50
Range [ ( max - min ) / 2 * 100% ] 19.82%
DPS
arcane Damage Per Second
Count 821
Mean 10911.66
Minimum 9988.69
Maximum 11824.00
Spread ( max - min ) 1835.31
Range [ ( max - min ) / 2 * 100% ] 8.41%
Standard Deviation 290.8741
5th Percentile 10458.15
95th Percentile 11372.29
( 95th Percentile - 5th Percentile ) 914.15
Mean Distribution
Standard Deviation 10.1516
95.00% Confidence Interval ( 10891.76 - 10931.55 )
Normalized 95.00% Confidence Interval ( 99.82% - 100.18% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 28
0.1% Error 2730
0.1 Scale Factor Error with Delta=300 723
0.05 Scale Factor Error with Delta=300 2890
0.01 Scale Factor Error with Delta=300 72227
Priority Target DPS
arcane Priority Target Damage Per Second
Count 821
Mean 4600.29
Minimum 4155.17
Maximum 5102.55
Spread ( max - min ) 947.38
Range [ ( max - min ) / 2 * 100% ] 10.30%
Standard Deviation 170.1218
5th Percentile 4319.34
95th Percentile 4879.82
( 95th Percentile - 5th Percentile ) 560.47
Mean Distribution
Standard Deviation 5.9373
95.00% Confidence Interval ( 4588.65 - 4611.92 )
Normalized 95.00% Confidence Interval ( 99.75% - 100.25% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 53
0.1% Error 5254
0.1 Scale Factor Error with Delta=300 248
0.05 Scale Factor Error with Delta=300 989
0.01 Scale Factor Error with Delta=300 24707
DPS(e)
arcane Damage Per Second (Effective)
Count 821
Mean 10911.66
Minimum 9988.69
Maximum 11824.00
Spread ( max - min ) 1835.31
Range [ ( max - min ) / 2 * 100% ] 8.41%
Damage
arcane Damage
Count 821
Mean 3282247.84
Minimum 2478623.43
Maximum 3913433.78
Spread ( max - min ) 1434810.35
Range [ ( max - min ) / 2 * 100% ] 21.86%
DTPS
arcane Damage Taken Per Second
Count 821
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
arcane Healing Per Second
Count 821
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
arcane Healing Per Second (Effective)
Count 821
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
arcane Heal
Count 821
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
arcane Healing Taken Per Second
Count 821
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
arcane Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
arcaneTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
arcane Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 variable,name=prepull_evo,op=reset,default=0
1 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
2 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
3 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
4 0.00 variable,name=have_opened,op=reset,default=0
5 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
6 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
7 0.00 variable,name=final_burn,op=set,value=0
8 0.00 variable,name=rs_max_delay,op=reset,default=5
9 0.00 variable,name=ap_max_delay,op=reset,default=10
A 0.00 variable,name=rop_max_delay,op=reset,default=20
B 0.00 variable,name=totm_max_delay,op=reset,default=5
C 0.00 variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
D 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
E 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
F 0.00 variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
G 0.00 variable,name=barrage_mana_pct,op=reset,default=70
H 0.00 variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
I 0.00 variable,name=ap_minimum_mana_pct,op=reset,default=30
J 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
K 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
L 0.00 variable,name=totm_max_charges,op=reset,default=2
M 0.00 variable,name=aoe_totm_max_charges,op=reset,default=2
N 0.00 variable,name=am_spam,op=reset,default=0
O 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
P 0.00 variable,name=am_spam_evo_pct,op=reset,default=15
Q 0.00 flask
R 0.00 food
S 0.00 augmentation
T 0.00 arcane_familiar
U 0.00 arcane_intellect
V 0.00 conjure_mana_gem
W 0.00 snapshot_stats
X 0.00 mirror_image
Y 0.00 frostbolt,if=variable.prepull_evo<=0
Z 0.00 evocation,if=variable.prepull_evo>0
Default action list Executed every time the actor is available.
# count action,conditions
0.00 counterspell,if=target.debuff.casting.react
a 0.00 call_action_list,name=shared_cds
b 0.00 call_action_list,name=essences
c 0.00 call_action_list,name=aoe,if=active_enemies>2
d 0.00 call_action_list,name=opener,if=variable.have_opened<=0
e 0.00 call_action_list,name=am_spam,if=variable.am_spam=1
f 0.00 call_action_list,name=cooldowns
g 0.00 call_action_list,name=rotation,if=variable.final_burn=0
h 0.00 call_action_list,name=final_burn,if=variable.final_burn=1
i 0.00 call_action_list,name=movement
actions.aoe
# count action,conditions
0.00 frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
0.00 arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
0.00 mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
j 6.16 touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
k 2.87 arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
l 5.96 rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
0.00 presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
0.00 arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
0.00 supernova
m 13.16 arcane_orb,if=buff.arcane_charge.stack=0
0.00 nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
0.00 shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
n 155.60 arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
0.00 arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
o 57.51 arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
p 1.20 evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.rotation
# count action,conditions
0.00 variable,name=final_burn,op=set,value=1,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&!buff.rule_of_threes.up&fight_remains<=((mana%action.arcane_blast.cost)*action.arcane_blast.execute_time)
0.00 arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8)
0.00 arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled)
0.00 arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)
0.00 arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&cooldown.arcane_power.remains<=gcd)
0.00 strict_sequence,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&buff.arcane_power.down&buff.rune_of_power.down,name=last_spark_stack:arcane_blast:arcane_barrage
0.00 arcane_barrage,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&(buff.arcane_power.down|buff.arcane_power.remains<=gcd)&(buff.rune_of_power.down|buff.rune_of_power.remains<=gcd)
0.00 arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
0.00 arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
0.00 arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&(debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time|cooldown.presence_of_mind.remains>0|covenant.kyrian.enabled)&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
0.00 arcane_missiles,if=buff.clearcasting.react&buff.expanded_potential.up
0.00 arcane_missiles,if=buff.clearcasting.react&(buff.arcane_power.up|buff.rune_of_power.up|debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time),chain=1
0.00 arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.stack=buff.clearcasting.max_stack,chain=1
0.00 arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.remains<=((buff.clearcasting.stack*action.arcane_missiles.execute_time)+gcd),chain=1
0.00 nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.arcane_power.down&debuff.touch_of_the_magi.down
0.00 arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges
0.00 supernova,if=mana.pct<=95&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
0.00 shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.evocation.remains>0&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
0.00 arcane_blast,if=buff.rule_of_threes.up&buff.arcane_charge.stack>3
0.00 arcane_barrage,if=mana.pct<variable.barrage_mana_pct&cooldown.evocation.remains>0&buff.arcane_power.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&essence.vision_of_perfection.minor
0.00 arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(cooldown.rune_of_power.remains=0|cooldown.arcane_power.remains=0)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
0.00 arcane_barrage,if=mana.pct<=variable.barrage_mana_pct&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&cooldown.evocation.remains>0
0.00 arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&talent.arcane_orb.enabled&cooldown.arcane_orb.remains<=gcd&mana.pct<=90&cooldown.evocation.remains>0
0.00 arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
0.00 arcane_barrage,if=buff.rune_of_power.up&buff.rune_of_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
0.00 arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
0.00 arcane_blast
0.00 evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
q 0.00 arcane_barrage
actions.shared_cds
# count action,conditions
r 2.78 use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
0.00 use_items,if=buff.arcane_power.up
s 1.00 potion,if=buff.arcane_power.up
0.00 time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
0.00 lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
0.00 bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
t 1.87 berserking,if=buff.arcane_power.up
0.00 blood_fury,if=buff.arcane_power.up
0.00 fireblood,if=buff.arcane_power.up
0.00 ancestral_call,if=buff.arcane_power.up

Sample Sequence

045789ABGILMNPQRVXYjkstomonnnnonnnnonnnnlonnnrnomonnnnonnnnonnnnonnnnomonnnnonnnnojlonnnnomonnnnonnnnonnnnomonnnnonnpjlomonnnnonnnnkonnnnomonnnnonnnrnonnnnojlomonnnnonnnnonnnnomonnnnonnnnonnnnojlomonnnnonnnnonnnnomonnnnonnnnonnnnojktomonnnnonnnrnonnnnlomonnnnonnnnonnnnomonnnnonnnpnomojlonnn

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 prepull_evo Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 4 have_opened Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 5 have_opened Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 7 final_burn Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 8 rs_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 9 ap_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat A rop_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat B totm_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat G barrage_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat I ap_minimum_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat L totm_max_charges Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat M aoe_totm_max_charges Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat N am_spam Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat P am_spam_evo_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat Q flask arcane 63371.4/63371: 100% mana
Pre precombat R food arcane 63371.4/63371: 100% mana
Pre precombat V conjure_mana_gem Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat X mirror_image Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat Y frostbolt Fluffy_Pillow 63371.4/63371: 100% mana
0:00.000 aoe j touch_of_the_magi Fluffy_Pillow 62371.4/63371: 98% mana
0:01.306 aoe k arcane_power Fluffy_Pillow 60876.5/63371: 96% mana bloodlust, arcane_charge(4)
0:01.306 shared_cds s potion Fluffy_Pillow 60876.5/63371: 96% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power
0:01.306 shared_cds t berserking Fluffy_Pillow 60876.5/63371: 96% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:01.306 aoe o arcane_barrage Fluffy_Pillow 60876.5/63371: 96% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:02.219 aoe m arcane_orb Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_power, rune_of_power, potion_of_deathly_fixation
0:03.134 aoe o arcane_barrage Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:04.048 aoe n arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_power, rune_of_power, potion_of_deathly_fixation
0:04.963 aoe n arcane_explosion Fluffy_Pillow 62031.1/63371: 98% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, potion_of_deathly_fixation
0:05.878 aoe n arcane_explosion Fluffy_Pillow 60690.8/63371: 96% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, potion_of_deathly_fixation
0:06.794 aoe n arcane_explosion Fluffy_Pillow 59351.8/63371: 94% mana bloodlust, berserking, arcane_charge(3), arcane_power, rune_of_power, potion_of_deathly_fixation
0:07.708 aoe o arcane_barrage Fluffy_Pillow 58010.2/63371: 92% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:08.622 aoe n arcane_explosion Fluffy_Pillow 61703.5/63371: 97% mana bloodlust, berserking, arcane_power, rune_of_power, potion_of_deathly_fixation
0:09.536 aoe n arcane_explosion Fluffy_Pillow 60361.9/63371: 95% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, potion_of_deathly_fixation
0:10.449 aoe n arcane_explosion Fluffy_Pillow 59019.1/63371: 93% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, potion_of_deathly_fixation
0:11.364 aoe n arcane_explosion Fluffy_Pillow 57678.8/63371: 91% mana bloodlust, berserking, arcane_charge(3), arcane_power, clearcasting, rune_of_power, potion_of_deathly_fixation
0:12.278 aoe o arcane_barrage Fluffy_Pillow 58837.2/63371: 93% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:13.191 aoe n arcane_explosion Fluffy_Pillow 62529.2/63371: 99% mana bloodlust, berserking, arcane_power, rune_of_power, potion_of_deathly_fixation
0:14.104 aoe n arcane_explosion Fluffy_Pillow 61186.4/63371: 97% mana bloodlust, arcane_charge, arcane_power, rune_of_power, potion_of_deathly_fixation
0:15.111 aoe n arcane_explosion Fluffy_Pillow 59962.7/63371: 95% mana bloodlust, arcane_charge(2), arcane_power, rune_of_power, potion_of_deathly_fixation
0:16.119 aoe n arcane_explosion Fluffy_Pillow 58740.3/63371: 93% mana bloodlust, arcane_charge(3), arcane_power, rune_of_power, potion_of_deathly_fixation
0:17.125 aoe l rune_of_power Fluffy_Pillow 57515.3/63371: 91% mana bloodlust, arcane_charge(4), potion_of_deathly_fixation
0:18.131 aoe o arcane_barrage Fluffy_Pillow 58790.3/63371: 93% mana bloodlust, arcane_charge(4), rune_of_power, potion_of_deathly_fixation
0:19.136 aoe n arcane_explosion Fluffy_Pillow 62599.0/63371: 99% mana bloodlust, rune_of_power, potion_of_deathly_fixation
0:20.141 aoe n arcane_explosion Fluffy_Pillow 58872.7/63371: 93% mana bloodlust, arcane_charge, rune_of_power, potion_of_deathly_fixation
0:21.146 aoe n arcane_explosion Fluffy_Pillow 55146.5/63371: 87% mana bloodlust, arcane_charge(2), rune_of_power, potion_of_deathly_fixation
0:22.152 shared_cds r use_mana_gem arcane 51421.5/63371: 81% mana bloodlust, arcane_charge(3), rune_of_power, potion_of_deathly_fixation
0:22.152 aoe n arcane_explosion Fluffy_Pillow 57758.7/63371: 91% mana bloodlust, arcane_charge(3), rune_of_power, potion_of_deathly_fixation
0:23.159 aoe o arcane_barrage Fluffy_Pillow 54035.0/63371: 85% mana bloodlust, arcane_charge(4), clearcasting, rune_of_power, potion_of_deathly_fixation
0:24.167 aoe m arcane_orb Fluffy_Pillow 57847.4/63371: 91% mana bloodlust, clearcasting, rune_of_power, potion_of_deathly_fixation
0:25.173 aoe o arcane_barrage Fluffy_Pillow 58622.4/63371: 93% mana bloodlust, arcane_charge(4), clearcasting, rune_of_power, potion_of_deathly_fixation
0:26.179 aoe n arcane_explosion Fluffy_Pillow 62432.3/63371: 99% mana bloodlust, clearcasting, rune_of_power, potion_of_deathly_fixation
0:27.185 aoe n arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, arcane_charge, rune_of_power
0:28.193 aoe n arcane_explosion Fluffy_Pillow 59649.0/63371: 94% mana bloodlust, arcane_charge(2), rune_of_power
0:29.201 aoe n arcane_explosion Fluffy_Pillow 55926.6/63371: 88% mana bloodlust, arcane_charge(3), rune_of_power
0:30.206 aoe o arcane_barrage Fluffy_Pillow 52200.3/63371: 82% mana bloodlust, arcane_charge(4), rune_of_power
0:31.214 aoe n arcane_explosion Fluffy_Pillow 56012.8/63371: 88% mana bloodlust, rune_of_power
0:32.222 aoe n arcane_explosion Fluffy_Pillow 52290.3/63371: 83% mana bloodlust, arcane_charge, rune_of_power
0:33.229 aoe n arcane_explosion Fluffy_Pillow 48566.6/63371: 77% mana bloodlust, arcane_charge(2)
0:34.236 aoe n arcane_explosion Fluffy_Pillow 44842.9/63371: 71% mana bloodlust, arcane_charge(3)
0:35.241 aoe o arcane_barrage Fluffy_Pillow 41116.7/63371: 65% mana bloodlust, arcane_charge(4), clearcasting
0:36.248 aoe n arcane_explosion Fluffy_Pillow 44927.8/63371: 71% mana bloodlust, clearcasting
0:37.255 aoe n arcane_explosion Fluffy_Pillow 46204.1/63371: 73% mana bloodlust, arcane_charge
0:38.263 aoe n arcane_explosion Fluffy_Pillow 42481.7/63371: 67% mana bloodlust, arcane_charge(2)
0:39.270 aoe n arcane_explosion Fluffy_Pillow 38758.0/63371: 61% mana bloodlust, arcane_charge(3)
0:40.276 aoe o arcane_barrage Fluffy_Pillow 35033.1/63371: 55% mana bloodlust, arcane_charge(4)
0:41.282 aoe n arcane_explosion Fluffy_Pillow 38842.9/63371: 61% mana
0:42.589 aoe n arcane_explosion Fluffy_Pillow 35499.5/63371: 56% mana arcane_charge, clearcasting
0:43.897 aoe n arcane_explosion Fluffy_Pillow 37157.3/63371: 59% mana arcane_charge(2)
0:45.203 aoe n arcane_explosion Fluffy_Pillow 33812.5/63371: 53% mana arcane_charge(3)
0:46.509 aoe o arcane_barrage Fluffy_Pillow 30467.8/63371: 48% mana arcane_charge(4)
0:47.816 aoe m arcane_orb Fluffy_Pillow 34659.2/63371: 55% mana
0:49.122 aoe o arcane_barrage Fluffy_Pillow 35814.4/63371: 57% mana arcane_charge(4)
0:50.429 aoe n arcane_explosion Fluffy_Pillow 40005.8/63371: 63% mana
0:51.736 aoe n arcane_explosion Fluffy_Pillow 36662.4/63371: 58% mana arcane_charge, clearcasting
0:53.042 aoe n arcane_explosion Fluffy_Pillow 38317.6/63371: 60% mana arcane_charge(2)
0:54.347 aoe n arcane_explosion Fluffy_Pillow 34971.6/63371: 55% mana arcane_charge(3)
0:55.654 aoe o arcane_barrage Fluffy_Pillow 31628.1/63371: 50% mana arcane_charge(4)
0:56.961 aoe n arcane_explosion Fluffy_Pillow 35819.5/63371: 57% mana
0:58.268 aoe n arcane_explosion Fluffy_Pillow 32476.1/63371: 51% mana arcane_charge
0:59.573 aoe n arcane_explosion Fluffy_Pillow 29130.0/63371: 46% mana arcane_charge(2), clearcasting
1:00.880 aoe n arcane_explosion Fluffy_Pillow 30786.6/63371: 49% mana arcane_charge(3)
1:02.187 aoe o arcane_barrage Fluffy_Pillow 27443.1/63371: 43% mana arcane_charge(4)
1:03.495 aoe j touch_of_the_magi Fluffy_Pillow 31635.8/63371: 50% mana
1:04.801 aoe l rune_of_power Fluffy_Pillow 30791.0/63371: 49% mana arcane_charge(4)
1:06.109 aoe o arcane_barrage Fluffy_Pillow 32448.8/63371: 51% mana arcane_charge(4), rune_of_power
1:07.415 aoe n arcane_explosion Fluffy_Pillow 36638.9/63371: 58% mana rune_of_power
1:08.721 aoe n arcane_explosion Fluffy_Pillow 33294.2/63371: 53% mana arcane_charge, rune_of_power
1:10.028 aoe n arcane_explosion Fluffy_Pillow 29950.7/63371: 47% mana arcane_charge(2), rune_of_power
1:11.336 aoe n arcane_explosion Fluffy_Pillow 26608.5/63371: 42% mana arcane_charge(3), rune_of_power
1:12.643 aoe o arcane_barrage Fluffy_Pillow 23265.1/63371: 37% mana arcane_charge(4), rune_of_power
1:13.950 aoe m arcane_orb Fluffy_Pillow 27456.4/63371: 43% mana rune_of_power
1:15.256 aoe o arcane_barrage Fluffy_Pillow 28611.7/63371: 45% mana arcane_charge(4), rune_of_power
1:16.562 aoe n arcane_explosion Fluffy_Pillow 32801.8/63371: 52% mana rune_of_power
1:17.868 aoe n arcane_explosion Fluffy_Pillow 29457.1/63371: 46% mana arcane_charge, clearcasting, rune_of_power
1:19.175 aoe n arcane_explosion Fluffy_Pillow 31113.6/63371: 49% mana arcane_charge(2), rune_of_power
1:20.482 aoe n arcane_explosion Fluffy_Pillow 27770.1/63371: 44% mana arcane_charge(3), rune_of_power
1:21.789 aoe o arcane_barrage Fluffy_Pillow 24426.7/63371: 39% mana arcane_charge(4)
1:23.097 aoe n arcane_explosion Fluffy_Pillow 28619.3/63371: 45% mana
1:24.404 aoe n arcane_explosion Fluffy_Pillow 25275.9/63371: 40% mana arcane_charge
1:25.711 aoe n arcane_explosion Fluffy_Pillow 21932.4/63371: 35% mana arcane_charge(2)
1:27.019 aoe n arcane_explosion Fluffy_Pillow 18590.2/63371: 29% mana arcane_charge(3)
1:28.327 aoe o arcane_barrage Fluffy_Pillow 15248.0/63371: 24% mana arcane_charge(4)
1:29.634 aoe n arcane_explosion Fluffy_Pillow 19439.4/63371: 31% mana
1:30.940 aoe n arcane_explosion Fluffy_Pillow 16094.6/63371: 25% mana arcane_charge
1:32.246 aoe n arcane_explosion Fluffy_Pillow 12749.9/63371: 20% mana arcane_charge(2)
1:33.552 aoe n arcane_explosion Fluffy_Pillow 9405.1/63371: 15% mana arcane_charge(3)
1:34.859 aoe o arcane_barrage Fluffy_Pillow 6061.7/63371: 10% mana arcane_charge(4)
1:36.167 aoe m arcane_orb Fluffy_Pillow 10254.3/63371: 16% mana
1:37.474 aoe o arcane_barrage Fluffy_Pillow 11410.9/63371: 18% mana arcane_charge(4)
1:38.782 aoe n arcane_explosion Fluffy_Pillow 15603.5/63371: 25% mana
1:40.088 aoe n arcane_explosion Fluffy_Pillow 12258.8/63371: 19% mana arcane_charge, clearcasting
1:41.394 aoe n arcane_explosion Fluffy_Pillow 13914.0/63371: 22% mana arcane_charge(2)
1:42.701 aoe n arcane_explosion Fluffy_Pillow 10570.6/63371: 17% mana arcane_charge(3)
1:44.009 aoe o arcane_barrage Fluffy_Pillow 7228.4/63371: 11% mana arcane_charge(4)
1:45.316 aoe n arcane_explosion Fluffy_Pillow 11419.7/63371: 18% mana
1:46.621 aoe n arcane_explosion Fluffy_Pillow 8073.7/63371: 13% mana arcane_charge
1:47.928 aoe p evocation arcane 4730.3/63371: 7% mana arcane_charge(2)
1:52.272 aoe j touch_of_the_magi Fluffy_Pillow 58574.9/63371: 92% mana arcane_charge(2)
1:53.578 aoe l rune_of_power Fluffy_Pillow 57730.2/63371: 91% mana arcane_charge(4), clearcasting
1:54.884 aoe o arcane_barrage Fluffy_Pillow 59385.5/63371: 94% mana arcane_charge(4), clearcasting, rune_of_power
1:56.191 aoe m arcane_orb Fluffy_Pillow 63371.4/63371: 100% mana clearcasting, rune_of_power
1:57.498 aoe o arcane_barrage Fluffy_Pillow 63371.4/63371: 100% mana arcane_charge(4), clearcasting, rune_of_power
1:58.804 aoe n arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana clearcasting, rune_of_power
2:00.111 aoe n arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana arcane_charge, rune_of_power
2:01.418 aoe n arcane_explosion Fluffy_Pillow 60028.0/63371: 95% mana arcane_charge(2), rune_of_power
2:02.726 aoe n arcane_explosion Fluffy_Pillow 56685.8/63371: 89% mana arcane_charge(3), rune_of_power
2:04.032 aoe o arcane_barrage Fluffy_Pillow 53341.0/63371: 84% mana arcane_charge(4), rune_of_power
2:05.338 aoe n arcane_explosion Fluffy_Pillow 57531.1/63371: 91% mana rune_of_power
2:06.643 aoe n arcane_explosion Fluffy_Pillow 54185.1/63371: 86% mana arcane_charge, rune_of_power
2:07.950 aoe n arcane_explosion Fluffy_Pillow 50841.7/63371: 80% mana arcane_charge(2), rune_of_power
2:09.256 aoe n arcane_explosion Fluffy_Pillow 47496.9/63371: 75% mana arcane_charge(3), clearcasting, rune_of_power
2:10.562 aoe k arcane_power Fluffy_Pillow 49152.2/63371: 78% mana arcane_charge(4)
2:10.562 aoe o arcane_barrage Fluffy_Pillow 49152.2/63371: 78% mana arcane_charge(4), arcane_power, rune_of_power
2:11.872 aoe n arcane_explosion Fluffy_Pillow 53347.4/63371: 84% mana arcane_power, rune_of_power
2:13.179 aoe n arcane_explosion Fluffy_Pillow 52503.9/63371: 83% mana arcane_charge, arcane_power, rune_of_power
2:14.484 aoe n arcane_explosion Fluffy_Pillow 51657.9/63371: 82% mana arcane_charge(2), arcane_power, rune_of_power
2:15.791 aoe n arcane_explosion Fluffy_Pillow 50814.4/63371: 80% mana arcane_charge(3), arcane_power, rune_of_power
2:17.098 aoe o arcane_barrage Fluffy_Pillow 49971.0/63371: 79% mana arcane_charge(4), arcane_power, rune_of_power
2:18.405 aoe m arcane_orb Fluffy_Pillow 54162.3/63371: 85% mana arcane_power, rune_of_power
2:19.711 aoe o arcane_barrage Fluffy_Pillow 55567.6/63371: 88% mana arcane_charge(4), arcane_power, rune_of_power
2:21.019 aoe n arcane_explosion Fluffy_Pillow 59760.3/63371: 94% mana arcane_power, rune_of_power
2:22.326 aoe n arcane_explosion Fluffy_Pillow 58916.8/63371: 93% mana arcane_charge, arcane_power, rune_of_power
2:23.632 aoe n arcane_explosion Fluffy_Pillow 58072.0/63371: 92% mana arcane_charge(2), arcane_power, rune_of_power
2:24.938 aoe n arcane_explosion Fluffy_Pillow 57227.3/63371: 90% mana arcane_charge(3), arcane_power, clearcasting, rune_of_power
2:26.246 aoe o arcane_barrage Fluffy_Pillow 58885.1/63371: 93% mana arcane_charge(4)
2:27.553 aoe n arcane_explosion Fluffy_Pillow 63076.5/63371: 100% mana
2:28.858 aoe n arcane_explosion Fluffy_Pillow 59730.5/63371: 94% mana arcane_charge
2:30.164 aoe n arcane_explosion Fluffy_Pillow 56385.7/63371: 89% mana arcane_charge(2)
2:31.471 shared_cds r use_mana_gem arcane 53042.3/63371: 84% mana arcane_charge(3), clearcasting
2:31.471 aoe n arcane_explosion Fluffy_Pillow 59379.4/63371: 94% mana arcane_charge(3), clearcasting
2:32.776 aoe o arcane_barrage Fluffy_Pillow 61033.4/63371: 96% mana arcane_charge(4)
2:34.081 aoe n arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana
2:35.388 aoe n arcane_explosion Fluffy_Pillow 60028.0/63371: 95% mana arcane_charge, clearcasting
2:36.695 aoe n arcane_explosion Fluffy_Pillow 61684.5/63371: 97% mana arcane_charge(2)
2:38.002 aoe n arcane_explosion Fluffy_Pillow 58341.0/63371: 92% mana arcane_charge(3)
2:39.311 aoe o arcane_barrage Fluffy_Pillow 55000.1/63371: 87% mana arcane_charge(4)
2:40.616 aoe j touch_of_the_magi Fluffy_Pillow 59188.9/63371: 93% mana
2:41.924 aoe l rune_of_power Fluffy_Pillow 58346.7/63371: 92% mana arcane_charge(4), clearcasting
2:43.231 aoe o arcane_barrage Fluffy_Pillow 60003.3/63371: 95% mana arcane_charge(4), clearcasting, rune_of_power
2:44.538 aoe m arcane_orb Fluffy_Pillow 63371.4/63371: 100% mana clearcasting, rune_of_power
2:45.845 aoe o arcane_barrage Fluffy_Pillow 63371.4/63371: 100% mana arcane_charge(4), clearcasting, rune_of_power
2:47.152 aoe n arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana clearcasting, rune_of_power
2:48.458 aoe n arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana arcane_charge, rune_of_power
2:49.765 aoe n arcane_explosion Fluffy_Pillow 60028.0/63371: 95% mana arcane_charge(2), rune_of_power
2:51.072 aoe n arcane_explosion Fluffy_Pillow 56684.5/63371: 89% mana arcane_charge(3), rune_of_power
2:52.379 aoe o arcane_barrage Fluffy_Pillow 53341.0/63371: 84% mana arcane_charge(4), rune_of_power
2:53.684 aoe n arcane_explosion Fluffy_Pillow 57529.9/63371: 91% mana rune_of_power
2:54.990 aoe n arcane_explosion Fluffy_Pillow 54185.1/63371: 86% mana arcane_charge, clearcasting, rune_of_power
2:56.297 aoe n arcane_explosion Fluffy_Pillow 55841.7/63371: 88% mana arcane_charge(2), rune_of_power
2:57.603 aoe n arcane_explosion Fluffy_Pillow 52496.9/63371: 83% mana arcane_charge(3), rune_of_power
2:58.910 aoe o arcane_barrage Fluffy_Pillow 49153.4/63371: 78% mana arcane_charge(4), clearcasting
3:00.216 aoe n arcane_explosion Fluffy_Pillow 53343.6/63371: 84% mana clearcasting
3:01.522 aoe n arcane_explosion Fluffy_Pillow 54998.8/63371: 87% mana arcane_charge
3:02.828 aoe n arcane_explosion Fluffy_Pillow 51654.1/63371: 82% mana arcane_charge(2)
3:04.136 aoe n arcane_explosion Fluffy_Pillow 48311.9/63371: 76% mana arcane_charge(3)
3:05.442 aoe o arcane_barrage Fluffy_Pillow 44967.1/63371: 71% mana arcane_charge(4)
3:06.748 aoe m arcane_orb Fluffy_Pillow 49157.3/63371: 78% mana
3:08.053 aoe o arcane_barrage Fluffy_Pillow 50311.3/63371: 79% mana arcane_charge(4)
3:09.359 aoe n arcane_explosion Fluffy_Pillow 54501.4/63371: 86% mana
3:10.667 aoe n arcane_explosion Fluffy_Pillow 51159.2/63371: 81% mana arcane_charge
3:11.974 aoe n arcane_explosion Fluffy_Pillow 47815.7/63371: 75% mana arcane_charge(2)
3:13.281 aoe n arcane_explosion Fluffy_Pillow 44472.2/63371: 70% mana arcane_charge(3)
3:14.586 aoe o arcane_barrage Fluffy_Pillow 41126.2/63371: 65% mana arcane_charge(4)
3:15.892 aoe n arcane_explosion Fluffy_Pillow 45316.3/63371: 72% mana
3:17.198 aoe n arcane_explosion Fluffy_Pillow 41971.6/63371: 66% mana arcane_charge
3:18.503 aoe n arcane_explosion Fluffy_Pillow 38625.6/63371: 61% mana arcane_charge(2)
3:19.811 aoe n arcane_explosion Fluffy_Pillow 35283.4/63371: 56% mana arcane_charge(3)
3:21.118 aoe o arcane_barrage Fluffy_Pillow 31939.9/63371: 50% mana arcane_charge(4)
3:22.425 aoe n arcane_explosion Fluffy_Pillow 36131.3/63371: 57% mana
3:23.731 aoe n arcane_explosion Fluffy_Pillow 32786.6/63371: 52% mana arcane_charge
3:25.038 aoe n arcane_explosion Fluffy_Pillow 29443.1/63371: 46% mana arcane_charge(2)
3:26.345 aoe n arcane_explosion Fluffy_Pillow 26099.6/63371: 41% mana arcane_charge(3)
3:27.653 aoe o arcane_barrage Fluffy_Pillow 22757.4/63371: 36% mana arcane_charge(4)
3:28.959 aoe j touch_of_the_magi Fluffy_Pillow 26947.6/63371: 43% mana
3:30.266 aoe l rune_of_power Fluffy_Pillow 26104.1/63371: 41% mana arcane_charge(4)
3:31.574 aoe o arcane_barrage Fluffy_Pillow 27761.9/63371: 44% mana arcane_charge(4), rune_of_power
3:32.879 aoe m arcane_orb Fluffy_Pillow 31950.7/63371: 50% mana rune_of_power
3:34.186 aoe o arcane_barrage Fluffy_Pillow 33107.3/63371: 52% mana arcane_charge(4), rune_of_power
3:35.493 aoe n arcane_explosion Fluffy_Pillow 37298.6/63371: 59% mana rune_of_power
3:36.799 aoe n arcane_explosion Fluffy_Pillow 33953.9/63371: 54% mana arcane_charge, rune_of_power
3:38.105 aoe n arcane_explosion Fluffy_Pillow 30609.2/63371: 48% mana arcane_charge(2), rune_of_power
3:39.412 aoe n arcane_explosion Fluffy_Pillow 27265.7/63371: 43% mana arcane_charge(3), rune_of_power
3:40.718 aoe o arcane_barrage Fluffy_Pillow 23921.0/63371: 38% mana arcane_charge(4), clearcasting, rune_of_power
3:42.024 aoe n arcane_explosion Fluffy_Pillow 28111.1/63371: 44% mana clearcasting, rune_of_power
3:43.331 aoe n arcane_explosion Fluffy_Pillow 29767.6/63371: 47% mana arcane_charge, rune_of_power
3:44.637 aoe n arcane_explosion Fluffy_Pillow 26422.9/63371: 42% mana arcane_charge(2), rune_of_power
3:45.943 aoe n arcane_explosion Fluffy_Pillow 23078.1/63371: 36% mana arcane_charge(3), rune_of_power
3:47.249 aoe o arcane_barrage Fluffy_Pillow 19733.4/63371: 31% mana arcane_charge(4)
3:48.556 aoe n arcane_explosion Fluffy_Pillow 23924.8/63371: 38% mana
3:49.863 aoe n arcane_explosion Fluffy_Pillow 20581.3/63371: 32% mana arcane_charge
3:51.169 aoe n arcane_explosion Fluffy_Pillow 17236.6/63371: 27% mana arcane_charge(2)
3:52.476 aoe n arcane_explosion Fluffy_Pillow 13893.1/63371: 22% mana arcane_charge(3)
3:53.783 aoe o arcane_barrage Fluffy_Pillow 10549.6/63371: 17% mana arcane_charge(4)
3:55.090 aoe m arcane_orb Fluffy_Pillow 14741.0/63371: 23% mana
3:56.397 aoe o arcane_barrage Fluffy_Pillow 15897.5/63371: 25% mana arcane_charge(4)
3:57.703 aoe n arcane_explosion Fluffy_Pillow 20087.7/63371: 32% mana
3:59.009 aoe n arcane_explosion Fluffy_Pillow 16742.9/63371: 26% mana arcane_charge
4:00.314 aoe n arcane_explosion Fluffy_Pillow 13396.9/63371: 21% mana arcane_charge(2), clearcasting
4:01.621 aoe n arcane_explosion Fluffy_Pillow 15053.4/63371: 24% mana arcane_charge(3)
4:02.928 aoe o arcane_barrage Fluffy_Pillow 11710.0/63371: 18% mana arcane_charge(4)
4:04.234 aoe n arcane_explosion Fluffy_Pillow 15900.1/63371: 25% mana
4:05.540 aoe n arcane_explosion Fluffy_Pillow 12555.4/63371: 20% mana arcane_charge
4:06.846 aoe n arcane_explosion Fluffy_Pillow 9210.6/63371: 15% mana arcane_charge(2)
4:08.152 aoe n arcane_explosion Fluffy_Pillow 5865.9/63371: 9% mana arcane_charge(3), clearcasting
4:09.459 aoe o arcane_barrage Fluffy_Pillow 7522.4/63371: 12% mana arcane_charge(4)
4:10.765 aoe n arcane_explosion Fluffy_Pillow 11712.5/63371: 18% mana
4:12.073 aoe n arcane_explosion Fluffy_Pillow 8370.3/63371: 13% mana arcane_charge, clearcasting
4:13.378 aoe n arcane_explosion Fluffy_Pillow 10024.3/63371: 16% mana arcane_charge(2)
4:14.684 aoe n arcane_explosion Fluffy_Pillow 6679.6/63371: 11% mana arcane_charge(3)
4:15.989 aoe o arcane_barrage Fluffy_Pillow 3333.6/63371: 5% mana arcane_charge(4), clearcasting
4:17.296 aoe j touch_of_the_magi Fluffy_Pillow 7525.0/63371: 12% mana clearcasting
4:18.603 aoe k arcane_power Fluffy_Pillow 6681.5/63371: 11% mana arcane_charge(4), clearcasting
4:18.603 shared_cds t berserking Fluffy_Pillow 6681.5/63371: 11% mana arcane_charge(4), arcane_power, clearcasting, rune_of_power
4:18.603 aoe o arcane_barrage Fluffy_Pillow 6681.5/63371: 11% mana berserking, arcane_charge(4), arcane_power, clearcasting, rune_of_power
4:19.791 aoe m arcane_orb Fluffy_Pillow 10722.1/63371: 17% mana berserking, arcane_power, clearcasting, rune_of_power
4:20.981 aoe o arcane_barrage Fluffy_Pillow 11980.3/63371: 19% mana berserking, arcane_charge(4), arcane_power, clearcasting, rune_of_power
4:22.170 aoe n arcane_explosion Fluffy_Pillow 16022.1/63371: 25% mana berserking, arcane_power, clearcasting, rune_of_power
4:23.359 aoe n arcane_explosion Fluffy_Pillow 17529.1/63371: 28% mana berserking, arcane_charge, arcane_power, rune_of_power
4:24.547 aoe n arcane_explosion Fluffy_Pillow 16534.8/63371: 26% mana berserking, arcane_charge(2), arcane_power, rune_of_power
4:25.737 aoe n arcane_explosion Fluffy_Pillow 15543.0/63371: 25% mana berserking, arcane_charge(3), arcane_power, rune_of_power
4:26.925 aoe o arcane_barrage Fluffy_Pillow 14548.7/63371: 23% mana berserking, arcane_charge(4), arcane_power, rune_of_power
4:28.113 aoe n arcane_explosion Fluffy_Pillow 18589.3/63371: 29% mana berserking, arcane_power, rune_of_power
4:29.301 aoe n arcane_explosion Fluffy_Pillow 17595.0/63371: 28% mana berserking, arcane_charge, arcane_power, clearcasting, rune_of_power
4:30.491 aoe n arcane_explosion Fluffy_Pillow 19103.3/63371: 30% mana berserking, arcane_charge(2), arcane_power, rune_of_power
4:31.678 shared_cds r use_mana_gem arcane 18107.7/63371: 29% mana arcane_charge(3), arcane_power, rune_of_power
4:31.678 aoe n arcane_explosion Fluffy_Pillow 24444.8/63371: 39% mana arcane_charge(3), arcane_power, rune_of_power
4:32.984 aoe o arcane_barrage Fluffy_Pillow 23600.1/63371: 37% mana arcane_charge(4), arcane_power, rune_of_power
4:34.290 aoe n arcane_explosion Fluffy_Pillow 27790.2/63371: 44% mana
4:35.596 aoe n arcane_explosion Fluffy_Pillow 24445.5/63371: 39% mana arcane_charge, clearcasting
4:36.904 aoe n arcane_explosion Fluffy_Pillow 26103.3/63371: 41% mana arcane_charge(2)
4:38.210 aoe n arcane_explosion Fluffy_Pillow 22758.5/63371: 36% mana arcane_charge(3), clearcasting
4:39.516 aoe l rune_of_power Fluffy_Pillow 24413.8/63371: 39% mana arcane_charge(4)
4:40.822 aoe o arcane_barrage Fluffy_Pillow 26069.1/63371: 41% mana arcane_charge(4), rune_of_power
4:42.130 aoe m arcane_orb Fluffy_Pillow 30261.7/63371: 48% mana rune_of_power
4:43.436 aoe o arcane_barrage Fluffy_Pillow 31417.0/63371: 50% mana arcane_charge(4), rune_of_power
4:44.744 aoe n arcane_explosion Fluffy_Pillow 35609.6/63371: 56% mana rune_of_power
4:46.050 aoe n arcane_explosion Fluffy_Pillow 32264.9/63371: 51% mana arcane_charge, rune_of_power
4:47.357 aoe n arcane_explosion Fluffy_Pillow 28921.4/63371: 46% mana arcane_charge(2), clearcasting, rune_of_power
4:48.663 aoe n arcane_explosion Fluffy_Pillow 30576.7/63371: 48% mana arcane_charge(3), rune_of_power
4:49.969 aoe o arcane_barrage Fluffy_Pillow 27231.9/63371: 43% mana arcane_charge(4), rune_of_power
4:51.276 aoe n arcane_explosion Fluffy_Pillow 31423.3/63371: 50% mana rune_of_power
4:52.582 aoe n arcane_explosion Fluffy_Pillow 28078.6/63371: 44% mana arcane_charge, rune_of_power
4:53.887 aoe n arcane_explosion Fluffy_Pillow 24732.6/63371: 39% mana arcane_charge(2), rune_of_power
4:55.194 aoe n arcane_explosion Fluffy_Pillow 21389.1/63371: 34% mana arcane_charge(3), rune_of_power
4:56.500 aoe o arcane_barrage Fluffy_Pillow 18044.4/63371: 28% mana arcane_charge(4)
4:57.805 aoe n arcane_explosion Fluffy_Pillow 22233.2/63371: 35% mana
4:59.112 aoe n arcane_explosion Fluffy_Pillow 18889.8/63371: 30% mana arcane_charge
5:00.417 aoe n arcane_explosion Fluffy_Pillow 15543.7/63371: 25% mana arcane_charge(2)
5:01.723 aoe n arcane_explosion Fluffy_Pillow 12199.0/63371: 19% mana arcane_charge(3)
5:03.032 aoe o arcane_barrage Fluffy_Pillow 8858.1/63371: 14% mana arcane_charge(4)
5:04.337 aoe m arcane_orb Fluffy_Pillow 13046.9/63371: 21% mana
5:05.643 aoe o arcane_barrage Fluffy_Pillow 14202.2/63371: 22% mana arcane_charge(4)
5:06.950 aoe n arcane_explosion Fluffy_Pillow 18393.6/63371: 29% mana
5:08.256 aoe n arcane_explosion Fluffy_Pillow 15048.8/63371: 24% mana arcane_charge
5:09.564 aoe n arcane_explosion Fluffy_Pillow 11706.6/63371: 18% mana arcane_charge(2)
5:10.872 aoe n arcane_explosion Fluffy_Pillow 8364.4/63371: 13% mana arcane_charge(3), clearcasting
5:12.180 aoe o arcane_barrage Fluffy_Pillow 10022.2/63371: 16% mana arcane_charge(4)
5:13.486 aoe n arcane_explosion Fluffy_Pillow 14212.3/63371: 22% mana
5:14.794 aoe n arcane_explosion Fluffy_Pillow 10870.1/63371: 17% mana arcane_charge
5:16.100 aoe n arcane_explosion Fluffy_Pillow 7525.4/63371: 12% mana arcane_charge(2)
5:17.405 aoe p evocation Fluffy_Pillow 4179.4/63371: 7% mana arcane_charge(3)
5:21.752 aoe n arcane_explosion Fluffy_Pillow 58027.9/63371: 92% mana arcane_charge(3)
5:23.058 aoe o arcane_barrage Fluffy_Pillow 54683.1/63371: 86% mana arcane_charge(4)
5:24.365 aoe m arcane_orb Fluffy_Pillow 58874.5/63371: 93% mana
5:25.670 aoe o arcane_barrage Fluffy_Pillow 60028.5/63371: 95% mana arcane_charge(4)
5:26.977 aoe j touch_of_the_magi Fluffy_Pillow 63371.4/63371: 100% mana
5:28.285 aoe l rune_of_power Fluffy_Pillow 60879.0/63371: 96% mana arcane_charge(4)
5:29.591 aoe o arcane_barrage Fluffy_Pillow 62534.3/63371: 99% mana arcane_charge(4), rune_of_power
5:30.898 aoe n arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana rune_of_power
5:32.203 aoe n arcane_explosion Fluffy_Pillow 60025.4/63371: 95% mana arcane_charge, rune_of_power
5:33.509 aoe n arcane_explosion Fluffy_Pillow 56680.7/63371: 89% mana arcane_charge(2), rune_of_power

Stats

Level Bonus (60) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 198 1 199 199 0
Agility 306 2 308 308 0
Stamina 414 0 434 414 0
Intellect 450 -3 2453 2247 1800
Spirit 0 0 0 0 0
Health 8680 8280 0
Mana 63371 63371 0
Spell Power 2453 2247 0
Crit 19.29% 19.29% 500
Haste 15.15% 15.15% 500
Versatility 12.50% 12.50% 500
Mana Regen 1267 1267 0
Mastery 26.74% 26.74% 500
Armor 0 0 0
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 0.00

Profile

mage="arcane"
source=default
spec=arcane
level=60
race=troll
role=spell
position=back
talents=1032021

# Default consumables
potion=deathly_fixation
flask=spectral_flask_of_power
food=feast_of_gluttonous_hedonism
augmentation=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=variable,name=prepull_evo,op=reset,default=0
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
actions.precombat+=/variable,name=have_opened,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
actions.precombat+=/variable,name=final_burn,op=set,value=0
actions.precombat+=/variable,name=rs_max_delay,op=reset,default=5
actions.precombat+=/variable,name=ap_max_delay,op=reset,default=10
actions.precombat+=/variable,name=rop_max_delay,op=reset,default=20
actions.precombat+=/variable,name=totm_max_delay,op=reset,default=5
actions.precombat+=/variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
actions.precombat+=/variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
actions.precombat+=/variable,name=barrage_mana_pct,op=reset,default=70
actions.precombat+=/variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=reset,default=30
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
actions.precombat+=/variable,name=totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=aoe_totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=am_spam,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
actions.precombat+=/variable,name=am_spam_evo_pct,op=reset,default=15
actions.precombat+=/flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/arcane_familiar
actions.precombat+=/arcane_intellect
actions.precombat+=/conjure_mana_gem
actions.precombat+=/snapshot_stats
actions.precombat+=/mirror_image
actions.precombat+=/frostbolt,if=variable.prepull_evo<=0
actions.precombat+=/evocation,if=variable.prepull_evo>0

# Executed every time the actor is available.
actions=counterspell,if=target.debuff.casting.react
actions+=/call_action_list,name=shared_cds
actions+=/call_action_list,name=essences
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/call_action_list,name=opener,if=variable.have_opened<=0
actions+=/call_action_list,name=am_spam,if=variable.am_spam=1
actions+=/call_action_list,name=cooldowns
actions+=/call_action_list,name=rotation,if=variable.final_burn=0
actions+=/call_action_list,name=final_burn,if=variable.final_burn=1
actions+=/call_action_list,name=movement

actions.am_spam=cancel_action,if=action.evocation.channeling&mana.pct>=95
actions.am_spam+=/evocation,if=mana.pct<=variable.am_spam_evo_pct&(cooldown.touch_of_the_magi.remains<=action.evocation.execute_time|cooldown.arcane_power.remains<=action.evocation.execute_time|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=action.evocation.execute_time))&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/rune_of_power,if=buff.rune_of_power.down&cooldown.arcane_power.remains>0
actions.am_spam+=/touch_of_the_magi,if=(cooldown.arcane_power.remains=0&buff.rune_of_power.down)|prev_gcd.1.rune_of_power
actions.am_spam+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&buff.rune_of_power.down&essence.vision_of_perfection.enabled
actions.am_spam+=/arcane_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.ap_max_delay
actions.am_spam+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=action.arcane_missiles.execute_time&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_barrage,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_missiles,if=buff.clearcasting.react,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/arcane_missiles,if=!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/evocation,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.am_spam+=/arcane_barrage
actions.am_spam+=/arcane_blast

actions.aoe=frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
actions.aoe+=/arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
actions.aoe+=/mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
actions.aoe+=/arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
actions.aoe+=/rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
actions.aoe+=/presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
actions.aoe+=/arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
actions.aoe+=/supernova
actions.aoe+=/arcane_orb,if=buff.arcane_charge.stack=0
actions.aoe+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
actions.aoe+=/arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1

# Prioritize using grisly icicle with ap. Use it with totm otherwise.
actions.cooldowns=frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.cooldowns+=/frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/fire_blast,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt
# Always use mirrors with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/mirrors_of_torment,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/mirrors_of_torment,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Always use deathborne with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/deathborne,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/deathborne,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use spark if totm and ap are on cd and won't be up for longer than the max delay, making sure we have at least two arcane charges and that totm wasn't just used.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack>2&debuff.touch_of_the_magi.down
# Use spark with ap when possible. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/radiant_spark,if=cooldown.arcane_power.remains=0&((!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct)
actions.cooldowns+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&essence.vision_of_perfection.minor
# Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken. Hold a bit to make sure we can RS immediately after totm ends
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8
# Non-Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken.
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
# Use ap if totm is on cd and won't be up for longer than the max delay, making sure that we have enough mana and that there is not already a rune of power down.
actions.cooldowns+=/arcane_power,if=(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use rop if totm is on cd and won't be up for longer than the max delay, making sure there isn't already a rune down and that ap won't become available during rune.
actions.cooldowns+=/rune_of_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.rop_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
# Kyrian: RS is mana hungry and AB4s are too expensive to use pom to squeeze an extra ab in the totm window. Let's use it to make low charge ABs instant.
actions.cooldowns+=/presence_of_mind,if=buff.arcane_charge.stack=0&covenant.kyrian.enabled
# Non-Kyrian: Use pom to squeeze an extra ab in the totm window.
actions.cooldowns+=/presence_of_mind,if=debuff.touch_of_the_magi.up&!covenant.kyrian.enabled

actions.essences=blood_of_the_enemy,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/blood_of_the_enemy,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains>=50&cooldown.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay
actions.essences+=/worldvein_resonance,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/guardian_of_azeroth,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/guardian_of_azeroth,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/concentrated_flame,line_cd=6,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/reaping_flames,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/focused_azerite_beam,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/purifying_blast,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/ripple_in_space,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/the_unbound_force,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/memory_of_lucid_dreams,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down

actions.final_burn=arcane_missiles,if=buff.clearcasting.react,chain=1
actions.final_burn+=/arcane_blast
actions.final_burn+=/arcane_barrage

actions.movement=blink_any,if=movement.distance>=10
actions.movement+=/presence_of_mind
actions.movement+=/arcane_missiles,if=movement.distance<10
actions.movement+=/arcane_orb
actions.movement+=/fire_blast

actions.opener=variable,name=have_opened,op=set,value=1,if=prev_gcd.1.evocation
actions.opener+=/fire_blast,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command_frost.up
actions.opener+=/frost_nova,if=runeforge.grisly_icicle.equipped&mana.pct>95
actions.opener+=/mirrors_of_torment
actions.opener+=/deathborne
actions.opener+=/radiant_spark,if=mana.pct>40
actions.opener+=/cancel_action,if=action.shifting_power.channeling&gcd.remains=0
actions.opener+=/shifting_power,if=soulbind.field_of_blossoms.enabled
actions.opener+=/touch_of_the_magi
actions.opener+=/arcane_power
actions.opener+=/rune_of_power,if=buff.rune_of_power.down
actions.opener+=/presence_of_mind
actions.opener+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.opener+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.opener+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.opener+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.opener+=/arcane_missiles,if=buff.clearcasting.react,chain=1
actions.opener+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges&(cooldown.arcane_power.remains>10|active_enemies<=2)
actions.opener+=/arcane_blast,if=buff.rune_of_power.up|mana.pct>15
actions.opener+=/evocation,if=buff.rune_of_power.down,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.opener+=/arcane_barrage

actions.rotation=variable,name=final_burn,op=set,value=1,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&!buff.rule_of_threes.up&fight_remains<=((mana%action.arcane_blast.cost)*action.arcane_blast.execute_time)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&cooldown.arcane_power.remains<=gcd)
actions.rotation+=/strict_sequence,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&buff.arcane_power.down&buff.rune_of_power.down,name=last_spark_stack:arcane_blast:arcane_barrage
actions.rotation+=/arcane_barrage,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&(buff.arcane_power.down|buff.arcane_power.remains<=gcd)&(buff.rune_of_power.down|buff.rune_of_power.remains<=gcd)
actions.rotation+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.rotation+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.rotation+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&(debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time|cooldown.presence_of_mind.remains>0|covenant.kyrian.enabled)&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.expanded_potential.up
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&(buff.arcane_power.up|buff.rune_of_power.up|debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.stack=buff.clearcasting.max_stack,chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.remains<=((buff.clearcasting.stack*action.arcane_missiles.execute_time)+gcd),chain=1
actions.rotation+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges
actions.rotation+=/supernova,if=mana.pct<=95&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.evocation.remains>0&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.rotation+=/arcane_blast,if=buff.rule_of_threes.up&buff.arcane_charge.stack>3
actions.rotation+=/arcane_barrage,if=mana.pct<variable.barrage_mana_pct&cooldown.evocation.remains>0&buff.arcane_power.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&essence.vision_of_perfection.minor
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(cooldown.rune_of_power.remains=0|cooldown.arcane_power.remains=0)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=mana.pct<=variable.barrage_mana_pct&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&talent.arcane_orb.enabled&cooldown.arcane_orb.remains<=gcd&mana.pct<=90&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.rune_of_power.up&buff.rune_of_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_blast
actions.rotation+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.rotation+=/arcane_barrage

actions.shared_cds=use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
actions.shared_cds+=/use_items,if=buff.arcane_power.up
actions.shared_cds+=/potion,if=buff.arcane_power.up
actions.shared_cds+=/time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
actions.shared_cds+=/lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/berserking,if=buff.arcane_power.up
actions.shared_cds+=/blood_fury,if=buff.arcane_power.up
actions.shared_cds+=/fireblood,if=buff.arcane_power.up
actions.shared_cds+=/ancestral_call,if=buff.arcane_power.up


# Gear Summary
# gear_ilvl=0.00
# gear_intellect=1800
# gear_crit_rating=500
# gear_haste_rating=500
# gear_mastery_rating=500
# gear_versatility_rating=500

Simulation & Raid Information

Iterations: 837
Threads: 16
Confidence: 95.00%
Fight Length (fixed time): 240 - 360 ( 301.5 )

Performance:

Total Events Processed: 6605855
Max Event Queue: 122
Sim Seconds: 252326
CPU Seconds: 12.1562
Physical Seconds: 1.8694
Speed Up: 20757

Settings:

World Lag: 100 ms ( stddev = 10 ms )
Queue Lag: 5 ms ( stddev = 1 ms )

Raw Ability Summary

Character Unit Ability Id Total DPS Imp/Min Hit Crit Execute Count Crit% Avoid% G% B% Interval Combined Duration
Kyrian Kyrian arcane_barrage 44425 1196653 3969 33.18 6022 12088 55.6 166.7 19.1% 0.0% 0.0% 0.0% 5.42sec 1196653 301.46sec
Kyrian Kyrian arcane_echo 342232 111422 370 35.36 527 1052 59.2 177.7 19.1% 0.0% 0.0% 0.0% 4.73sec 111422 301.46sec
Kyrian Kyrian arcane_explosion 1449 1512810 5018 89.22 2830 5659 149.4 448.3 19.3% 0.0% 0.0% 0.0% 1.98sec 1512810 301.46sec
Kyrian Kyrian arcane_orb 153626 0 0 0.00 0 0 12.8 0.0 0.0% 0.0% 0.0% 0.0% 24.15sec 0 301.46sec
Kyrian Kyrian arcane_orb_bolt 153640 253581 841 7.66 5522 11077 38.5 38.5 19.3% 0.0% 0.0% 0.0% 24.15sec 253581 301.46sec
Kyrian Kyrian arcane_power 12042 0 0 0.00 0 0 2.8 0.0 0.0% 0.0% 0.0% 0.0% 131.36sec 0 301.46sec
Kyrian Kyrian berserking 26297 0 0 0.00 0 0 1.8 0.0 0.0% 0.0% 0.0% 0.0% 262.83sec 0 301.46sec
Kyrian Kyrian conjure_mana_gem 759 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.46sec
Kyrian Kyrian deathly_fixation 322253 0 0 0.00 0 0 14.7 0.0 0.0% 0.0% 0.0% 0.0% 1.77sec 0 301.46sec
Kyrian Kyrian deathly_eruption 322256 20368 68 2.93 1164 2327 14.7 14.7 19.1% 0.0% 0.0% 0.0% 1.77sec 20368 301.46sec
Kyrian Kyrian evocation 12051 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 157.64sec 0 301.46sec
Kyrian Kyrian flask 307185 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.46sec
Kyrian Kyrian food 308462 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.46sec
Kyrian Kyrian frostbolt 116 1755 6 0.20 1481 2961 0.0 1.0 18.5% 0.0% 0.0% 0.0% 0.00sec 1755 301.46sec
Kyrian Kyrian mirror_image 55342 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.46sec
Kyrian Kyrian_mirror_image frostbolt 59638 6102 153 135.00 57 114 90.0 90.0 19.4% 0.0% 0.0% 0.0% 1.29sec 6102 40.00sec
Kyrian Kyrian potion 307497 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.46sec
Kyrian Kyrian radiant_spark 307443 33987 113 1.85 3042 6147 9.3 9.3 19.7% 0.0% 0.0% 0.0% 34.00sec 57005 301.46sec
Kyrian Kyrian radiant_spark ticks -307443 23018 77 12.09 319 639 9.3 60.5 19.3% 0.0% 0.0% 0.0% 34.00sec 57005 301.46sec
Kyrian Kyrian rune_of_power 116011 0 0 0.00 0 0 5.8 0.0 0.0% 0.0% 0.0% 0.0% 53.26sec 0 301.46sec
Kyrian Kyrian touch_of_the_magi 321507 0 0 0.00 0 0 5.9 0.0 0.0% 0.0% 0.0% 0.0% 54.77sec 0 301.46sec
Kyrian Kyrian touch_of_the_magi_explosion 210833 204988 680 3.54 11529 0 5.9 17.8 0.0% 0.0% 0.0% 0.0% 54.63sec 204988 301.46sec
Kyrian Kyrian use_mana_gem 5405 0 0 0.00 0 0 2.8 0.0 0.0% 0.0% 0.0% 0.0% 123.24sec 0 301.46sec
Necrolord Necrolord arcane_barrage 44425 951086 3155 29.68 5353 10676 49.8 149.1 19.3% 0.0% 0.0% 0.0% 5.68sec 951086 301.46sec
Necrolord Necrolord arcane_blast 30451 817842 2713 17.13 7950 15986 29.8 86.0 19.3% 0.0% 0.0% 0.0% 8.55sec 817842 301.46sec
Necrolord Necrolord arcane_echo 342232 74864 248 22.65 552 1106 37.9 113.8 19.1% 0.0% 0.0% 0.0% 7.49sec 74864 301.46sec
Necrolord Necrolord arcane_explosion 1449 1192650 3956 77.39 2569 5150 129.6 388.8 19.3% 0.0% 0.0% 0.0% 2.13sec 1192650 301.46sec
Necrolord Necrolord arcane_orb 153626 0 0 0.00 0 0 11.6 0.0 0.0% 0.0% 0.0% 0.0% 25.02sec 0 301.46sec
Necrolord Necrolord arcane_orb_bolt 153640 206094 684 6.89 5000 10027 34.6 34.6 19.0% 0.0% 0.0% 0.0% 25.03sec 206094 301.46sec
Necrolord Necrolord arcane_power 12042 0 0 0.00 0 0 2.8 0.0 0.0% 0.0% 0.0% 0.0% 129.36sec 0 301.46sec
Necrolord Necrolord berserking 26297 0 0 0.00 0 0 1.8 0.0 0.0% 0.0% 0.0% 0.0% 258.68sec 0 301.46sec
Necrolord Necrolord conjure_mana_gem 759 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.46sec
Necrolord Necrolord deathborne 324220 0 0 0.00 0 0 1.8 0.0 0.0% 0.0% 0.0% 0.0% 258.78sec 0 301.46sec
Necrolord Necrolord deathly_fixation 322253 0 0 0.00 0 0 13.5 0.0 0.0% 0.0% 0.0% 0.0% 1.82sec 0 301.46sec
Necrolord Necrolord deathly_eruption 322256 18760 62 2.68 1164 2327 13.5 13.5 19.5% 0.0% 0.0% 0.0% 1.82sec 18760 301.46sec
Necrolord Necrolord evocation 12051 0 0 0.00 0 0 2.1 0.0 0.0% 0.0% 0.0% 0.0% 172.53sec 0 301.46sec
Necrolord Necrolord flask 307185 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.46sec
Necrolord Necrolord food 308462 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.46sec
Necrolord Necrolord frostbolt 116 1753 6 0.20 1481 2961 0.0 1.0 18.4% 0.0% 0.0% 0.0% 0.00sec 1753 301.46sec
Necrolord Necrolord mirror_image 55342 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.46sec
Necrolord Necrolord_mirror_image frostbolt 59638 6034 151 135.00 56 112 90.0 90.0 19.3% 0.0% 0.0% 0.0% 1.29sec 6034 40.00sec
Necrolord Necrolord potion 307497 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.46sec
Necrolord Necrolord presence_of_mind 205025 0 0 0.00 0 0 1.8 0.0 0.0% 0.0% 0.0% 0.0% 257.47sec 0 301.46sec
Necrolord Necrolord rune_of_power 116011 0 0 0.00 0 0 6.0 0.0 0.0% 0.0% 0.0% 0.0% 51.20sec 0 301.46sec
Necrolord Necrolord touch_of_the_magi 321507 0 0 0.00 0 0 6.1 0.0 0.0% 0.0% 0.0% 0.0% 52.44sec 0 301.46sec
Necrolord Necrolord touch_of_the_magi_explosion 210833 202438 672 3.66 11019 0 6.1 18.4 0.0% 0.0% 0.0% 0.0% 52.34sec 202438 301.46sec
Necrolord Necrolord use_mana_gem 5405 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 121.18sec 0 301.46sec
Night_Fae Night_Fae arcane_barrage 44425 1212941 4023 32.49 6241 12456 54.5 163.2 19.2% 0.0% 0.0% 0.0% 5.55sec 1212941 301.46sec
Night_Fae Night_Fae arcane_echo 342232 87062 289 24.81 586 1172 41.5 124.6 19.2% 0.0% 0.0% 0.0% 6.92sec 87062 301.46sec
Night_Fae Night_Fae arcane_explosion 1449 1524441 5057 85.53 2974 5946 143.2 429.7 19.3% 0.0% 0.0% 0.0% 2.08sec 1524441 301.46sec
Night_Fae Night_Fae arcane_orb 153626 0 0 0.00 0 0 13.9 0.0 0.0% 0.0% 0.0% 0.0% 22.34sec 0 301.46sec
Night_Fae Night_Fae arcane_orb_bolt 153640 265643 881 8.30 5333 10693 41.7 41.7 19.3% 0.0% 0.0% 0.0% 22.34sec 265643 301.46sec
Night_Fae Night_Fae arcane_power 12042 0 0 0.00 0 0 3.6 0.0 0.0% 0.0% 0.0% 0.0% 97.18sec 0 301.46sec
Night_Fae Night_Fae berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 194.71sec 0 301.46sec
Night_Fae Night_Fae conjure_mana_gem 759 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.46sec
Night_Fae Night_Fae deathly_fixation 322253 0 0 0.00 0 0 18.8 0.0 0.0% 0.0% 0.0% 0.0% 10.30sec 0 301.46sec
Night_Fae Night_Fae deathly_eruption 322256 26078 87 3.74 1164 2327 18.8 18.8 19.3% 0.0% 0.0% 0.0% 10.30sec 26078 301.46sec
Night_Fae Night_Fae evocation 12051 0 0 0.00 0 0 0.3 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.46sec
Night_Fae Night_Fae flask 307185 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.46sec
Night_Fae Night_Fae food 308462 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.46sec
Night_Fae Night_Fae frostbolt 116 1773 6 0.20 1481 2961 0.0 1.0 19.7% 0.0% 0.0% 0.0% 0.00sec 1773 301.46sec
Night_Fae Night_Fae mirror_image 55342 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.46sec
Night_Fae Night_Fae_mirror_image frostbolt 59638 6030 151 135.00 56 112 90.0 90.0 19.2% 0.0% 0.0% 0.0% 1.29sec 6030 40.00sec
Night_Fae Night_Fae potion 307497 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 300.43sec 0 301.46sec
Night_Fae Night_Fae rune_of_power 116011 0 0 0.00 0 0 6.4 0.0 0.0% 0.0% 0.0% 0.0% 47.92sec 0 301.46sec
Night_Fae Night_Fae shifting_power ticks -314791 116094 387 4.73 1372 2745 5.9 23.6 19.3% 0.0% 0.0% 0.0% 49.48sec 116094 301.46sec
Night_Fae Night_Fae touch_of_the_magi 321507 0 0 0.00 0 0 6.6 0.0 0.0% 0.0% 0.0% 0.0% 49.08sec 0 301.46sec
Night_Fae Night_Fae touch_of_the_magi_explosion 210833 190365 631 3.92 9687 0 6.6 19.7 0.0% 0.0% 0.0% 0.0% 48.93sec 190365 301.46sec
Night_Fae Night_Fae use_mana_gem 5405 0 0 0.00 0 0 2.8 0.0 0.0% 0.0% 0.0% 0.0% 120.62sec 0 301.46sec
Venthyr Venthyr arcane_barrage 44425 1203706 3993 34.07 5905 11784 57.1 171.2 19.2% 0.0% 0.0% 0.0% 5.28sec 1203706 301.46sec
Venthyr Venthyr arcane_echo 342232 81581 271 25.48 534 1069 42.7 128.0 19.3% 0.0% 0.0% 0.0% 6.65sec 81581 301.46sec
Venthyr Venthyr arcane_explosion 1449 1540103 5109 91.93 2796 5584 154.0 461.9 19.4% 0.0% 0.0% 0.0% 1.93sec 1540103 301.46sec
Venthyr Venthyr arcane_orb 153626 0 0 0.00 0 0 13.2 0.0 0.0% 0.0% 0.0% 0.0% 23.45sec 0 301.46sec
Venthyr Venthyr arcane_orb_bolt 153640 254486 844 7.88 5387 10818 39.6 39.6 19.2% 0.0% 0.0% 0.0% 23.45sec 254486 301.46sec
Venthyr Venthyr arcane_power 12042 0 0 0.00 0 0 2.8 0.0 0.0% 0.0% 0.0% 0.0% 129.11sec 0 301.46sec
Venthyr Venthyr berserking 26297 0 0 0.00 0 0 1.8 0.0 0.0% 0.0% 0.0% 0.0% 258.14sec 0 301.46sec
Venthyr Venthyr conjure_mana_gem 759 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.46sec
Venthyr Venthyr deathly_fixation 322253 0 0 0.00 0 0 14.7 0.0 0.0% 0.0% 0.0% 0.0% 1.78sec 0 301.46sec
Venthyr Venthyr deathly_eruption 322256 20443 68 2.93 1164 2327 14.7 14.7 19.5% 0.0% 0.0% 0.0% 1.78sec 20443 301.46sec
Venthyr Venthyr evocation 12051 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 174.44sec 0 301.46sec
Venthyr Venthyr flask 307185 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.46sec
Venthyr Venthyr food 308462 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.46sec
Venthyr Venthyr frostbolt 116 1758 6 0.20 1481 2961 0.0 1.0 18.8% 0.0% 0.0% 0.0% 0.00sec 1758 301.46sec
Venthyr Venthyr mirror_image 55342 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.46sec
Venthyr Venthyr_mirror_image frostbolt 59638 6091 152 135.00 57 113 90.0 90.0 19.2% 0.0% 0.0% 0.0% 1.29sec 6091 40.00sec
Venthyr Venthyr mirrors_of_torment 314793 0 0 0.00 0 0 2.7 0.0 0.0% 0.0% 0.0% 0.0% 138.68sec 0 301.46sec
Venthyr Venthyr agonizing_backlash 320035 19227 64 1.06 3061 6134 5.3 5.3 18.3% 0.0% 0.0% 0.0% 55.70sec 19227 301.46sec
Venthyr Venthyr tormenting_backlash 317589 24495 81 0.51 8024 16186 2.6 2.6 18.2% 0.0% 0.0% 0.0% 139.64sec 24495 301.46sec
Venthyr Venthyr potion 307497 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.46sec
Venthyr Venthyr rune_of_power 116011 0 0 0.00 0 0 5.9 0.0 0.0% 0.0% 0.0% 0.0% 51.99sec 0 301.46sec
Venthyr Venthyr touch_of_the_magi 321507 0 0 0.00 0 0 6.1 0.0 0.0% 0.0% 0.0% 0.0% 53.26sec 0 301.46sec
Venthyr Venthyr touch_of_the_magi_explosion 210833 178900 593 3.62 9853 0 6.1 18.2 0.0% 0.0% 0.0% 0.0% 53.16sec 178900 301.46sec
Venthyr Venthyr use_mana_gem 5405 0 0 0.00 0 0 2.7 0.0 0.0% 0.0% 0.0% 0.0% 124.63sec 0 301.46sec
arcane arcane arcane_barrage 44425 1214772 4030 34.30 5902 11851 57.5 172.3 19.3% 0.0% 0.0% 0.0% 5.26sec 1214772 301.46sec
arcane arcane arcane_echo 342232 70487 234 22.10 532 1063 37.0 111.0 19.4% 0.0% 0.0% 0.0% 7.61sec 70487 301.46sec
arcane arcane arcane_explosion 1449 1554486 5156 92.91 2788 5587 155.6 466.8 19.4% 0.0% 0.0% 0.0% 1.91sec 1554486 301.46sec
arcane arcane arcane_orb 153626 0 0 0.00 0 0 13.2 0.0 0.0% 0.0% 0.0% 0.0% 23.63sec 0 301.46sec
arcane arcane arcane_orb_bolt 153640 257863 855 7.85 5459 10920 39.5 39.5 19.7% 0.0% 0.0% 0.0% 23.62sec 257863 301.46sec
arcane arcane arcane_power 12042 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 128.51sec 0 301.46sec
arcane arcane berserking 26297 0 0 0.00 0 0 1.9 0.0 0.0% 0.0% 0.0% 0.0% 256.94sec 0 301.46sec
arcane arcane conjure_mana_gem 759 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.46sec
arcane arcane deathly_fixation 322253 0 0 0.00 0 0 14.5 0.0 0.0% 0.0% 0.0% 0.0% 1.75sec 0 301.46sec
arcane arcane deathly_eruption 322256 20034 66 2.88 1164 2327 14.5 14.5 19.0% 0.0% 0.0% 0.0% 1.75sec 20034 301.46sec
arcane arcane evocation 12051 0 0 0.00 0 0 1.2 0.0 0.0% 0.0% 0.0% 0.0% 169.99sec 0 301.46sec
arcane arcane flask 307185 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.46sec
arcane arcane food 308462 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.46sec
arcane arcane frostbolt 116 1807 6 0.20 1481 2961 0.0 1.0 22.0% 0.0% 0.0% 0.0% 0.00sec 1807 301.46sec
arcane arcane mirror_image 55342 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.46sec
arcane arcane_mirror_image frostbolt 59638 6039 151 135.00 56 112 90.0 90.0 19.3% 0.0% 0.0% 0.0% 1.29sec 6039 40.00sec
arcane arcane potion 307497 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.46sec
arcane arcane rune_of_power 116011 0 0 0.00 0 0 5.9 0.0 0.0% 0.0% 0.0% 0.0% 51.45sec 0 301.46sec
arcane arcane touch_of_the_magi 321507 0 0 0.00 0 0 6.2 0.0 0.0% 0.0% 0.0% 0.0% 52.41sec 0 301.46sec
arcane arcane touch_of_the_magi_explosion 210833 162799 540 3.67 8843 0 6.2 18.4 0.0% 0.0% 0.0% 0.0% 52.34sec 162799 301.46sec
arcane arcane use_mana_gem 5405 0 0 0.00 0 0 2.8 0.0 0.0% 0.0% 0.0% 0.0% 123.43sec 0 301.46sec

Fluffy_Pillow : 0 dps, 0 dps to main target

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
22673.5 0.0 Health 0.00% 0.0 100.0% 100%
Talents
  • 15: None
  • 25: None
  • 30: None
  • 35: None
  • 40: None
  • 45: None
  • 50: None
  • Talent Calculator

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Health Decade (0 - 10) 0.7 0.0 0.0sec 0.0sec 39.0sec 8.35% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 104.5s

Stack Uptimes

  • Health Decade (0 - 10)_1:8.39%
Health Decade (10 - 20) 0.9 0.0 0.0sec 0.0sec 21.4sec 6.05% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.3s / 39.1s

Stack Uptimes

  • Health Decade (10 - 20)_1:6.05%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 23.9sec 7.78% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 35.7s

Stack Uptimes

  • Health Decade (20 - 30)_1:7.78%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 31.0sec 10.34% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:18.0s / 43.1s

Stack Uptimes

  • Health Decade (30 - 40)_1:10.34%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 35.6sec 11.81% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:20.1s / 50.0s

Stack Uptimes

  • Health Decade (40 - 50)_1:11.81%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 37.4sec 12.53% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:25.2s / 54.9s

Stack Uptimes

  • Health Decade (50 - 60)_1:12.53%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 40.8sec 13.70% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:32.9s / 47.0s

Stack Uptimes

  • Health Decade (60 - 70)_1:13.70%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 45.7sec 15.38% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:30.8s / 56.3s

Stack Uptimes

  • Health Decade (70 - 80)_1:15.38%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 29.2sec 9.82% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:12.6s / 50.1s

Stack Uptimes

  • Health Decade (80 - 90)_1:9.82%
Health Decade (90 - 100) 1.0 0.0 0.0sec 0.0sec 18.1sec 4.23% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (90 - 100)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:9.3s / 300.0s

Stack Uptimes

  • Health Decade (90 - 100)_1:4.23%
Mirrors of Torment 2.7 0.0 136.2sec 137.8sec 13.2sec 11.78% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Venthyr
  • cooldown name:buff_mirrors_of_torment
  • max_stacks:3
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:refresh
  • tick_time behavior:unhasted
  • period:1.50

Trigger Details

  • interval_min/max:1.3s / 165.8s
  • trigger_min/max:97.1s / 165.8s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 13.5s

Stack Uptimes

  • mirrors_of_torment_1:5.17%
  • mirrors_of_torment_2:5.28%
  • mirrors_of_torment_3:1.34%

Spelldata

  • id:314793
  • name:Mirrors of Torment
  • tooltip:Attacking, casting a spell or ability, consumes a mirror to inflict Shadow damage and reduce cast and movement speed by $320035s3%. Your final mirror will instead Root and Silence you for {$317589d=4 seconds}.
  • description:Conjure $n mirrors to torment the enemy for {$d=25 seconds}. Whenever the target attacks, casts a spell, or uses an ability, a mirror is consumed to inflict $320035s1 Shadow damage and their movement and cast speed are slowed by $320035s3%. This effect cannot be triggered more often than once per {$345977d=6 seconds}. The final mirror will instead inflict $317589s1 Shadow damage to the enemy, Rooting and Silencing them for {$317589d=4 seconds}. Whenever a mirror is consumed $?c1[you gain $345417s1% mana][]$?c2[your Fire Blast cooldown is reduced by $s2 sec][]$?c3[you gain Brain Freeze][].
  • max_stacks:0
  • duration:25.00
  • cooldown:90.00
  • default_chance:100.00%
Radiant Spark Vulnerability 9.4 27.5 33.4sec 7.9sec 4.8sec 14.83% 0.00% 0.0 (0.0) 0.1

Buff Details

  • buff initial source:Kyrian
  • cooldown name:buff_radiant_spark_vulnerability
  • max_stacks:4
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.10
  • activated:false
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.7s / 56.6s
  • trigger_min/max:0.5s / 52.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.0s

Stack Uptimes

  • radiant_spark_vulnerability_1:3.84%
  • radiant_spark_vulnerability_2:3.72%
  • radiant_spark_vulnerability_3:3.52%
  • radiant_spark_vulnerability_4:3.75%

Spelldata

  • id:307454
  • name:Radiant Spark Vulnerability
  • tooltip:Damage taken from $@auracaster increased by $w1%.
  • description:{$@spelldesc307443=Conjure a radiant spark that causes $s1 Arcane damage instantly, and an additional $o2 damage over {$d=10 seconds}. The target takes $307454s1% increased damage from your direct damage spells, stacking each time they are struck. This effect ends after {$307454u=4} spells. }
  • max_stacks:4
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Touch of the Magi 6.2 0.0 52.3sec 52.4sec 7.9sec 16.21% 0.00% 0.0 (0.0) 6.0

Buff Details

  • buff initial source:arcane
  • cooldown name:buff_touch_of_the_magi
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.3s / 73.6s
  • trigger_min/max:46.3s / 73.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.0s

Stack Uptimes

  • touch_of_the_magi_1:16.21%

Spelldata

  • id:210824
  • name:Touch of the Magi
  • tooltip:Will explode for $w1 Arcane damage upon expiration.
  • description:{$@spelldesc210725=Arcane Blast has a {$h=10}% chance to apply Touch of the Magi, accumulating $s1% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and all nearby enemies.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
Touch of the Magi 6.6 0.0 49.0sec 49.1sec 7.9sec 17.24% 0.00% 0.0 (0.0) 6.4

Buff Details

  • buff initial source:Night_Fae
  • cooldown name:buff_touch_of_the_magi
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.3s / 57.9s
  • trigger_min/max:38.9s / 57.9s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 8.0s

Stack Uptimes

  • touch_of_the_magi_1:17.24%

Spelldata

  • id:210824
  • name:Touch of the Magi
  • tooltip:Will explode for $w1 Arcane damage upon expiration.
  • description:{$@spelldesc210725=Arcane Blast has a {$h=10}% chance to apply Touch of the Magi, accumulating $s1% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and all nearby enemies.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
Touch of the Magi 6.1 0.0 53.1sec 53.3sec 7.9sec 15.96% 0.00% 0.0 (0.0) 5.9

Buff Details

  • buff initial source:Venthyr
  • cooldown name:buff_touch_of_the_magi
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:2.3s / 73.8s
  • trigger_min/max:46.3s / 73.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.0s

Stack Uptimes

  • touch_of_the_magi_1:15.96%

Spelldata

  • id:210824
  • name:Touch of the Magi
  • tooltip:Will explode for $w1 Arcane damage upon expiration.
  • description:{$@spelldesc210725=Arcane Blast has a {$h=10}% chance to apply Touch of the Magi, accumulating $s1% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and all nearby enemies.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
Touch of the Magi 5.9 0.0 54.5sec 54.7sec 7.9sec 15.58% 0.00% 0.0 (0.0) 5.8

Buff Details

  • buff initial source:Kyrian
  • cooldown name:buff_touch_of_the_magi
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:2.3s / 76.2s
  • trigger_min/max:47.4s / 76.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.0s

Stack Uptimes

  • touch_of_the_magi_1:15.58%

Spelldata

  • id:210824
  • name:Touch of the Magi
  • tooltip:Will explode for $w1 Arcane damage upon expiration.
  • description:{$@spelldesc210725=Arcane Blast has a {$h=10}% chance to apply Touch of the Magi, accumulating $s1% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and all nearby enemies.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
Touch of the Magi 6.1 0.0 52.3sec 52.5sec 7.9sec 16.17% 0.00% 0.0 (0.0) 6.0

Buff Details

  • buff initial source:Necrolord
  • cooldown name:buff_touch_of_the_magi
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:2.3s / 71.6s
  • trigger_min/max:46.3s / 71.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.0s

Stack Uptimes

  • touch_of_the_magi_1:16.17%

Spelldata

  • id:210824
  • name:Touch of the Magi
  • tooltip:Will explode for $w1 Arcane damage upon expiration.
  • description:{$@spelldesc210725=Arcane Blast has a {$h=10}% chance to apply Touch of the Magi, accumulating $s1% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and all nearby enemies.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_bleeding
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
Chaos Brand

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by $s1%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by $1490s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by $w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by $113746s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max

Statistics & Data Analysis

Fight Length
Fluffy_Pillow Fight Length
Count 821
Mean 301.46
Minimum 240.16
Maximum 359.65
Spread ( max - min ) 119.50
Range [ ( max - min ) / 2 * 100% ] 19.82%
DPS
Fluffy_Pillow Damage Per Second
Count 821
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Fluffy_Pillow Priority Target Damage Per Second
Count 821
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
Fluffy_Pillow Damage Per Second (Effective)
Count 821
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Fluffy_Pillow Damage
Count 821
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Fluffy_Pillow Damage Taken Per Second
Count 821
Mean 24019.88
Minimum 22390.61
Maximum 25557.32
Spread ( max - min ) 3166.70
Range [ ( max - min ) / 2 * 100% ] 6.59%
Standard Deviation 501.0044
5th Percentile 23253.11
95th Percentile 24865.95
( 95th Percentile - 5th Percentile ) 1612.84
Mean Distribution
Standard Deviation 17.4852
95.00% Confidence Interval ( 23985.61 - 24054.15 )
Normalized 95.00% Confidence Interval ( 99.86% - 100.14% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 17
0.1% Error 1672
0.1 Scale Factor Error with Delta=300 2143
0.05 Scale Factor Error with Delta=300 8571
0.01 Scale Factor Error with Delta=300 214273
HPS
Fluffy_Pillow Healing Per Second
Count 821
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
Fluffy_Pillow Healing Per Second (Effective)
Count 821
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Fluffy_Pillow Heal
Count 821
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Fluffy_Pillow Healing Taken Per Second
Count 821
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Fluffy_Pillow Theck-Meloree Index
Count 821
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Fluffy_PillowTheck-Meloree Index (Effective)
Count 821
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Fluffy_Pillow Max Spike Value
Count 131
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (63) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0 0 0
Agility 0 0 0 0 0
Stamina 0 0 0 0 0
Intellect 0 0 0 0 0
Spirit 0 0 0 0 0
Health 0 6387056 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 1071 1071 1071
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

enemy="Fluffy_Pillow"
source=default
spec=unknown
level=63
race=humanoid
role=tank
position=front
talents=0000000

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

enemy2 : 0 dps, 0 dps to main target

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
14805.0 0.0 Health 0.00% 0.0 100.0% 100%
Talents
  • 15: None
  • 25: None
  • 30: None
  • 35: None
  • 40: None
  • 45: None
  • 50: None
  • Talent Calculator

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Health Decade (0 - 10) 0.7 0.0 0.0sec 0.0sec 45.0sec 9.95% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 116.2s

Stack Uptimes

  • Health Decade (0 - 10)_1:10.06%
Health Decade (10 - 20) 0.9 0.0 0.0sec 0.0sec 24.2sec 6.93% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 40.1s

Stack Uptimes

  • Health Decade (10 - 20)_1:6.93%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 27.6sec 9.04% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.5s / 37.8s

Stack Uptimes

  • Health Decade (20 - 30)_1:9.04%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 33.2sec 11.09% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:22.8s / 42.0s

Stack Uptimes

  • Health Decade (30 - 40)_1:11.09%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 34.6sec 11.58% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:20.8s / 49.1s

Stack Uptimes

  • Health Decade (40 - 50)_1:11.58%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 33.6sec 11.28% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:24.6s / 50.6s

Stack Uptimes

  • Health Decade (50 - 60)_1:11.28%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 38.1sec 12.81% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:28.9s / 44.7s

Stack Uptimes

  • Health Decade (60 - 70)_1:12.81%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 41.3sec 13.91% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:28.5s / 52.0s

Stack Uptimes

  • Health Decade (70 - 80)_1:13.91%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 27.1sec 9.12% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:14.4s / 46.4s

Stack Uptimes

  • Health Decade (80 - 90)_1:9.12%
Health Decade (90 - 100) 1.0 0.0 0.0sec 0.0sec 18.2sec 4.28% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (90 - 100)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:9.9s / 300.0s

Stack Uptimes

  • Health Decade (90 - 100)_1:4.28%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_bleeding
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
Chaos Brand

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by $s1%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by $1490s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by $w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by $113746s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max

Deaths

death count 642
death count pct 76.70
avg death time 301.91
min death time 241.53
max death time 358.44
dmg taken 4771748.07

Statistics & Data Analysis

Fight Length
enemy2 Fight Length
Count 821
Mean 301.46
Minimum 240.16
Maximum 359.65
Spread ( max - min ) 119.50
Range [ ( max - min ) / 2 * 100% ] 19.82%
DPS
enemy2 Damage Per Second
Count 821
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
enemy2 Priority Target Damage Per Second
Count 821
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
enemy2 Damage Per Second (Effective)
Count 821
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
enemy2 Damage
Count 821
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
enemy2 Damage Taken Per Second
Count 821
Mean 15837.18
Minimum 15170.22
Maximum 16570.18
Spread ( max - min ) 1399.95
Range [ ( max - min ) / 2 * 100% ] 4.42%
Standard Deviation 277.7218
5th Percentile 15416.70
95th Percentile 16292.45
( 95th Percentile - 5th Percentile ) 875.75
Mean Distribution
Standard Deviation 9.6926
95.00% Confidence Interval ( 15818.18 - 15856.18 )
Normalized 95.00% Confidence Interval ( 99.88% - 100.12% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 12
0.1% Error 1182
0.1 Scale Factor Error with Delta=300 659
0.05 Scale Factor Error with Delta=300 2634
0.01 Scale Factor Error with Delta=300 65843
HPS
enemy2 Healing Per Second
Count 821
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
enemy2 Healing Per Second (Effective)
Count 821
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
enemy2 Heal
Count 821
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
enemy2 Healing Taken Per Second
Count 821
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
enemy2 Theck-Meloree Index
Count 821
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
enemy2Theck-Meloree Index (Effective)
Count 821
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
enemy2 Max Spike Value
Count 131
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (63) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0 0 0
Agility 0 0 0 0 0
Stamina 0 0 0 0 0
Intellect 0 0 0 0 0
Spirit 0 0 0 0 0
Health 0 4939658 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 1071 1071 1071
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

enemy="enemy2"
source=default
spec=unknown
level=63
race=humanoid
role=tank
position=front
talents=0000000

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

enemy3 : 0 dps, 0 dps to main target

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
15219.6 0.0 Health 0.00% 0.0 100.0% 100%
Talents
  • 15: None
  • 25: None
  • 30: None
  • 35: None
  • 40: None
  • 45: None
  • 50: None
  • Talent Calculator

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Health Decade (0 - 10) 0.8 0.0 0.0sec 0.0sec 42.8sec 10.06% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 121.7s

Stack Uptimes

  • Health Decade (0 - 10)_1:10.10%
Health Decade (10 - 20) 0.9 0.0 0.0sec 0.0sec 24.2sec 7.11% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 39.6s

Stack Uptimes

  • Health Decade (10 - 20)_1:7.13%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 28.4sec 9.36% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:1.2s / 38.7s

Stack Uptimes

  • Health Decade (20 - 30)_1:9.36%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 34.1sec 11.38% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:23.4s / 42.9s

Stack Uptimes

  • Health Decade (30 - 40)_1:11.38%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 35.3sec 11.79% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:20.9s / 50.5s

Stack Uptimes

  • Health Decade (40 - 50)_1:11.79%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 34.6sec 11.62% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:25.8s / 50.2s

Stack Uptimes

  • Health Decade (50 - 60)_1:11.62%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 39.7sec 13.33% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:29.6s / 46.6s

Stack Uptimes

  • Health Decade (60 - 70)_1:13.33%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 41.3sec 13.87% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:25.8s / 53.3s

Stack Uptimes

  • Health Decade (70 - 80)_1:13.87%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 22.3sec 7.49% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:11.2s / 39.9s

Stack Uptimes

  • Health Decade (80 - 90)_1:7.49%
Health Decade (90 - 100) 1.0 0.0 0.0sec 0.0sec 17.4sec 3.98% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (90 - 100)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:9.6s / 300.0s

Stack Uptimes

  • Health Decade (90 - 100)_1:3.98%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_bleeding
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
Chaos Brand

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by $s1%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by $1490s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by $w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by $113746s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max

Deaths

death count 642
death count pct 76.70
avg death time 301.91
min death time 241.53
max death time 358.44
dmg taken 4875404.13

Statistics & Data Analysis

Fight Length
enemy3 Fight Length
Count 821
Mean 301.46
Minimum 240.16
Maximum 359.65
Spread ( max - min ) 119.50
Range [ ( max - min ) / 2 * 100% ] 19.82%
DPS
enemy3 Damage Per Second
Count 821
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
enemy3 Priority Target Damage Per Second
Count 821
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
enemy3 Damage Per Second (Effective)
Count 821
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
enemy3 Damage
Count 821
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
enemy3 Damage Taken Per Second
Count 821
Mean 16182.14
Minimum 15448.90
Maximum 16918.35
Spread ( max - min ) 1469.45
Range [ ( max - min ) / 2 * 100% ] 4.54%
Standard Deviation 279.8204
5th Percentile 15749.46
95th Percentile 16651.86
( 95th Percentile - 5th Percentile ) 902.40
Mean Distribution
Standard Deviation 9.7658
95.00% Confidence Interval ( 16163.00 - 16201.28 )
Normalized 95.00% Confidence Interval ( 99.88% - 100.12% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 12
0.1% Error 1149
0.1 Scale Factor Error with Delta=300 669
0.05 Scale Factor Error with Delta=300 2674
0.01 Scale Factor Error with Delta=300 66841
HPS
enemy3 Healing Per Second
Count 821
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
enemy3 Healing Per Second (Effective)
Count 821
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
enemy3 Heal
Count 821
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
enemy3 Healing Taken Per Second
Count 821
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
enemy3 Theck-Meloree Index
Count 821
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
enemy3Theck-Meloree Index (Effective)
Count 821
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
enemy3 Max Spike Value
Count 131
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (63) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0 0 0
Agility 0 0 0 0 0
Stamina 0 0 0 0 0
Intellect 0 0 0 0 0
Spirit 0 0 0 0 0
Health 0 4426051 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 1071 1071 1071
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

enemy="enemy3"
source=default
spec=unknown
level=63
race=humanoid
role=tank
position=front
talents=0000000

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

APM

Average number of actions executed per minute.

APS

Average absorption per active player duration.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Execute

Average number of times an action is executed per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

DPSE

Average damage per fight duration.

DTPS

Average damage taken per second per active player duration.

HPS

Average healing (and absorption) per active player duration.

HPSE

Average healing (and absorption) per fight duration.

HPE

Average healing (or absorb) per execution of an individual action.

HPET

Average healing (or absorb) per execute time of an individual action; the amount of healing generated, divided by the time taken to execute the action, including time spent in the GCD.

HPR

Average healing (or absorb) per resource point spent.

Count

Average count of impacts per iteration.

Dodge%

Percentage of executes that resulted in dodges.

DPS%

Percentage of total DPS contributed by a particular action.

HPS%

Percentage of total HPS (including absorb) contributed by a particular action.

Theck-Meloree Index

Measure of damage smoothness, calculated over entire fight length. Related to max spike damage, 1k TMI is roughly equivalent to 1% of your health. TMI ignores external healing and absorbs. Lower is better.

TMI bin size

Time bin size used to calculate TMI and MSD, in seconds.

Type

Direct or Periodic damage.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Buff Benefit

The percentage of times the buff had a actual benefit for its mainly intended purpose, eg. damage buffed / spell executes.

Glance%

Percentage of executes that resulted in glancing blows.

Block%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability.

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

Miss%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

Gain per unit stat increase except for Hit/Expertise which represent Loss per unit stat decrease.

Gear Amount

Amount from raw gear, before class, attunement, or buff modifiers. Amount from hybrid primary stats (i.e. Agility/Intellect) shown in parentheses.

Stats Raid Buffed

Amount after all static buffs have been accounted for. Dynamic buffs (i.e. trinkets, potions) not included.

Stats Unbuffed

Amount after class modifiers and effects, but before buff modifiers.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

Ticks Crit

Average crit tick damage.

Ticks Crit%

Percentage of ticks that resulted in critical strikes.

Ticks Hit

Average non-crit tick damage.

Ticks Miss%

Percentage of ticks that resulted in misses, dodges or parries.

Ticks Uptime%

Percentage of total time that DoT is ticking on target.

Ticks Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.

Scale Factor Ranking

This row ranks the scale factors from highest to lowest, checking whether one scale factor is higher/lower than another with statistical significance.

Uptime Average Duration

The average duration of an instance of the tracked uptime.

TMI Range

This is the range of TMI values containing 95.00% of the data, roughly centered on the mean.

TMI/MSD Window

Window length used to calculate TMI and MSD, in seconds.

Max Spike Damage

Maximum amount of net damage taken in any N-second period (default 6sec), expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Error

Estimator for the 95.00% confidence interval.

Range

This is the range of values containing 95.00% of the data, roughly centered on the mean.

Fight Length

Fight Length: 300.00
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.